Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PCTP antibodyFormalin Fixed Paraffin Embedded Tissue: Human AdrenalPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit PCTP Polyclonal Antibody | anti-PCTP antibody

PCTP Antibody

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Immunohistochemistry
Purity
Affinity Purified
Synonyms
PCTP; Polyclonal Antibody; PCTP Antibody; Phosphatidylcholine transfer protein; AGTRAP; UBC; ACOT13; PAX3; PC-TP; STARD2; anti-PCTP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP
Applicable Applications for anti-PCTP antibody
Immunohistochemistry (IHC)
Protein Size
214 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP
Predicted Homology Based on Immunogen Sequence
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 77%; Human: 100%; Rabbit: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PCTP antibodyFormalin Fixed Paraffin Embedded Tissue: Human AdrenalPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-PCTP antibodyFormalin Fixed Paraffin Embedded Tissue: Human AdrenalPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-PCTP antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-PCTP antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(Host: RabbitTarget Name: PCTP1Sample Type: Lane 1: 40 ug Human Liver lysateLane 2: 40 ug Mouse Liver lysateLane 3: 40 ug Rat Liver lysatePrimary Antibody Dilution: 1:1000Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647Secondary Antibody Dilution: 1:2500Submitted by: Hua Jiang, University of Colorado. )

Western Blot (WB) (Host: RabbitTarget Name: PCTP1Sample Type: Lane 1: 40 ug Human Liver lysateLane 2: 40 ug Mouse Liver lysateLane 3: 40 ug Rat Liver lysatePrimary Antibody Dilution: 1:1000Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647Secondary Antibody Dilution: 1:2500Submitted by: Hua Jiang, University of Colorado. )

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
25kDa
UniProt Protein Name
Phosphatidylcholine transfer protein
Protein Family
UniProt Gene Name
PCTP
UniProt Synonym Gene Names
STARD2; PC-TP; StARD2
UniProt Entry Name
PPCT_HUMAN

Uniprot Description

PCTP: Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q21-q24

Cellular Component: cytosol

Molecular Function: phosphatidylcholine transmembrane transporter activity; phosphatidylcholine binding

Biological Process: cholesterol metabolic process; phospholipid transport; lipid transport

Similar Products

Product Notes

The PCTP pctp (Catalog #AAA3249658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCTP Antibody reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCTP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the PCTP pctp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLEDCSPTLL ADIYMDSDYR KQWDQYVKEL YEQECNGETV VYWEVKYPFP. It is sometimes possible for the material contained within the vial of "PCTP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.