Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PCTK3 expression in transfected 293T cell line using MBS6010142. Lane 1: PCTK3 transfected lysate (52.14kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PCTK3 Polyclonal Antibody | anti-CDK18 antibody

PCTK3 (CDK18, PCTK3, Cyclin-dependent Kinase 18, Cell Division Protein Kinase 18, PCTAIRE-motif Protein Kinase 3, Serine/Threonine-protein Kinase PCTAIRE-3)

Gene Names
CDK18; PCTK3; PCTAIRE; PCTAIRE3
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
PCTK3; Polyclonal Antibody; PCTK3 (CDK18; Cyclin-dependent Kinase 18; Cell Division Protein Kinase 18; PCTAIRE-motif Protein Kinase 3; Serine/Threonine-protein Kinase PCTAIRE-3); Anti -PCTK3 (CDK18; anti-CDK18 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PCTK3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.4
Concentration
0.37mg/ml (varies by lot)
Sequence
MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
Applicable Applications for anti-CDK18 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Grade
Purified
Immunogen
Full length human PCTK3, aa1-474 (NP_002587.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PCTK3 expression in transfected 293T cell line using MBS6010142. Lane 1: PCTK3 transfected lysate (52.14kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PCTK3 expression in transfected 293T cell line using MBS6010142. Lane 1: PCTK3 transfected lysate (52.14kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CDK18 antibody
PCTK3 may play a role in signal transduction cascades in terminally differentiated cells.
Product Categories/Family for anti-CDK18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
54,180 Da
NCBI Official Full Name
PCTK3 protein, partial
NCBI Official Synonym Full Names
cyclin-dependent kinase 18
NCBI Official Symbol
CDK18
NCBI Official Synonym Symbols
PCTK3; PCTAIRE; PCTAIRE3
NCBI Protein Information
cyclin-dependent kinase 18; PCTAIRE protein kinase 3; PCTAIRE-motif protein kinase 3; cell division protein kinase 18; serine/threonine-protein kinase PCTAIRE-3
UniProt Protein Name
Cyclin-dependent kinase 18
Protein Family
UniProt Gene Name
CDK18
UniProt Synonym Gene Names
PCTAIRE3; PCTK3
UniProt Entry Name
CDK18_HUMAN

Uniprot Description

CDK18: a CMGC kinase of the CDK family. May play a role in terminally differentiated cells.

Protein type: Protein kinase, Ser/Thr (non-receptor); Cell cycle regulation; Kinase, protein; Motility/polarity/chemotaxis; Protein kinase, CMGC; EC 2.7.11.22; CMGC group; CDK family; TAIRE subfamily; CDK/TAIRE subfamily

Chromosomal Location of Human Ortholog: 1q31-q32

Molecular Function: protein binding; cyclin-dependent protein kinase activity; ATP binding

Biological Process: regulation of cell cycle; protein amino acid phosphorylation

Research Articles on CDK18

Similar Products

Product Notes

The CDK18 cdk18 (Catalog #AAA6010142) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCTK3 (CDK18, PCTK3, Cyclin-dependent Kinase 18, Cell Division Protein Kinase 18, PCTAIRE-motif Protein Kinase 3, Serine/Threonine-protein Kinase PCTAIRE-3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCTK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CDK18 cdk18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MIMNKMKNFK RRFSLSVPRT ETIEESLAEF TEQFNQLHNR RNENLQLGPL GRDPPQECST FSPTDSGEEP GQLSPGVQFQ RRQNQRRFSM EDVSKRLSLP MDIRLPQEFL QKLQMESPDL PKPLSRMSRR ASLSDIGFGK LETYVKLDKL GEGTYATVFK GRSKLTENLV ALKEIRLEHE EGAPCTAIRE VSLLKNLKHA NIVTLHDLIH TDRSLTLVFE YLDSDLKQYL DHCGNLMSMH NVKIFMFQLL RGLAYCHHRK ILHRDLKPQN LLINERGELK LADFGLARAK SVPTKTYSNE VVTLWYRPPD VLLGSTEYST PIDMWGVGCI HYEMATGRPL FPGSTVKEEL HLIFRLLGTP TEETWPGVTA FSEFRTYSFP CYLPQPLINH APRLDTDGIH LLSSLLLYES KSRMSAEAAL SHSYFRSLGE RVHQLEDTAS IFSLKEIQLQ KDPGYRGLAF QQPGRGKNRR QSIF. It is sometimes possible for the material contained within the vial of "PCTK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.