Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PCSK4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

Rabbit PCSK4 Polyclonal Antibody | anti-PCSK4 antibody

PCSK4 antibody - N-terminal region

Gene Names
PCSK4; PC4; SPC5
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PCSK4; Polyclonal Antibody; PCSK4 antibody - N-terminal region; anti-PCSK4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT
Sequence Length
755
Applicable Applications for anti-PCSK4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PCSK4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PCSK4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-PCSK4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-PCSK4 antibody
This is a rabbit polyclonal antibody against PCSK4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR; MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 AC027307.5 80201-80231 c 32-257 AY358963.1 32-257 258-655 AK057235.1 452-849 656-2528 AY358963.1 656-2528 2529-2606 AL043305.1 210-287 2607-2674 AA453604.1 1-68 c
Product Categories/Family for anti-PCSK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
proprotein convertase subtilisin/kexin type 4 preproprotein
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 4
NCBI Official Symbol
PCSK4
NCBI Official Synonym Symbols
PC4; SPC5
NCBI Protein Information
proprotein convertase subtilisin/kexin type 4
UniProt Protein Name
Proprotein convertase subtilisin/kexin type 4
UniProt Gene Name
PCSK4
UniProt Synonym Gene Names
PC4
UniProt Entry Name
PCSK4_HUMAN

NCBI Description

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to subcellular compartments where a second autocatalytic even takes place and the catalytic activity is acquired. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. The protease is expressed only in the testis, placenta, and ovary. It plays a critical role in fertilization, fetoplacental growth, and embryonic development and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein and pro-insulin-like growth factor II. [provided by RefSeq, Jan 2014]

Uniprot Description

PCSK4: Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Plays a role in transcriptional coactivation. May be involved in stabilizing the multiprotein transcription complex. Belongs to the peptidase S8 family. Furin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Membrane protein, integral; EC 3.4.21.-; Cell development/differentiation

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: integral to membrane; acrosomal membrane

Molecular Function: serine-type endopeptidase activity

Biological Process: binding of sperm to zona pellucida; acrosome reaction; proteolysis; sperm capacitation

Research Articles on PCSK4

Similar Products

Product Notes

The PCSK4 pcsk4 (Catalog #AAA3213999) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCSK4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCSK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PCSK4 pcsk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSSWAVQVSQ GNREVERLAR KFGFVNLGPI FPDGQYFHLR HRGVVQQSLT. It is sometimes possible for the material contained within the vial of "PCSK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.