Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PBOV1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlPBOV1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human PBOV1 Polyclonal Antibody | anti-PBOV1 antibody

PBOV1 Antibody - N-terminal region

Gene Names
PBOV1; UC28; UROC28; dJ171N11.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PBOV1; Polyclonal Antibody; PBOV1 Antibody - N-terminal region; anti-PBOV1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQ
Sequence Length
135
Applicable Applications for anti-PBOV1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PBOV1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PBOV1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlPBOV1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: PBOV1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlPBOV1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PBOV1 antibody
This is a rabbit polyclonal antibody against PBOV1. It was validated on Western Blot

Target Description: This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer.
Product Categories/Family for anti-PBOV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
prostate and breast cancer overexpressed gene 1 protein
NCBI Official Synonym Full Names
prostate and breast cancer overexpressed 1
NCBI Official Symbol
PBOV1
NCBI Official Synonym Symbols
UC28; UROC28; dJ171N11.2
NCBI Protein Information
prostate and breast cancer overexpressed gene 1 protein
UniProt Protein Name
Prostate and breast cancer overexpressed gene 1 protein
UniProt Gene Name
PBOV1
UniProt Synonym Gene Names
UROC28; UC28
UniProt Entry Name
PBOV1_HUMAN

NCBI Description

This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer. [provided by RefSeq, Aug 2011]

Uniprot Description

PBOV1:

Chromosomal Location of Human Ortholog: 6q23.3

Cellular Component: cytoplasm; nucleus

Research Articles on PBOV1

Similar Products

Product Notes

The PBOV1 pbov1 (Catalog #AAA3217106) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PBOV1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PBOV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PBOV1 pbov1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RHRLSNFPRL PGILAPETVL LPFCYKVFRK KEKVKRSQKA TEFIDYSIEQ. It is sometimes possible for the material contained within the vial of "PBOV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.