Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PAX2 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit PAX2 Polyclonal Antibody | anti-PAX2 antibody

PAX2 antibody - middle region

Gene Names
PAX2; FSGS7; PAPRS
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PAX2; Polyclonal Antibody; PAX2 antibody - middle region; anti-PAX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS
Sequence Length
417
Applicable Applications for anti-PAX2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PAX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PAX2 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-PAX2 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Sample Type: Human MCF7WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Western Blot (WB) (Sample Type: Human MCF7WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Western Blot (WB)

(Host: RabbitTarget Name: PAX2Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PAX2Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:312500Positive Control: Fetal Kidney)

Western Blot (WB) (WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:312500Positive Control: Fetal Kidney)
Related Product Information for anti-PAX2 antibody
This is a rabbit polyclonal antibody against PAX2. It was validated on Western Blot and immunohistochemistry

Target Description: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
paired box protein Pax-2 isoform c
NCBI Official Synonym Full Names
paired box 2
NCBI Official Symbol
PAX2
NCBI Official Synonym Symbols
FSGS7; PAPRS
NCBI Protein Information
paired box protein Pax-2
UniProt Protein Name
Paired box protein Pax-2
Protein Family
UniProt Gene Name
PAX2
UniProt Entry Name
PAX2_HUMAN

NCBI Description

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

PAX2: Probable transcription factor that may have a role in kidney cell differentiation. Has a critical role in the development of the urogenital tract, the eyes, and the CNS. Interacts with ELGN3; the interaction targets PAX2 for destruction. Expressed in primitive cells of the kidney, ureter, eye, ear and central nervous system. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: protein complex; lysosome; microtubule organizing center; nucleus

Molecular Function: protein binding; DNA binding; superoxide-generating NADPH oxidase activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of cytolysis; optic nerve structural organization; positive regulation of transcription, DNA-dependent; cell fate determination; negative regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; pronephros development; glial cell differentiation; vestibulocochlear nerve formation; visual perception; pancreas development; negative regulation of programmed cell death; protein kinase B signaling cascade; brain morphogenesis; mesonephros development; aging; response to nutrient levels; inner ear morphogenesis; camera-type eye development; transcription, DNA-dependent; optic cup morphogenesis involved in camera-type eye development; stem cell differentiation; optic nerve morphogenesis; axonogenesis; optic nerve development; ureteric bud branching; neural tube closure; mesodermal cell fate specification; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; urogenital system development; positive regulation of epithelial cell proliferation; negative regulation of apoptosis

Disease: Papillorenal Syndrome; Renal Hypodysplasia/aplasia 1; Focal Segmental Glomerulosclerosis 7

Research Articles on PAX2

Similar Products

Product Notes

The PAX2 pax2 (Catalog #AAA3224634) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAX2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PAX2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PAX2 pax2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSSASNDPVG SYSINGILGI PRSNGEKRKR DEDVSEGSVP NGDSQSGVDS. It is sometimes possible for the material contained within the vial of "PAX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.