Immunohistochemistry (IHC)
(Human Muscle )
Rabbit PAWR Polyclonal Antibody | anti-PAWR antibody
PAWR antibody - middle region
Gene Names
PAWR; PAR4; Par-4
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PAWR; Polyclonal Antibody; PAWR antibody - middle region; anti-PAWR antibody
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLL
Sequence Length
340
Applicable Applications for anti-PAWR antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PAWR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Muscle )
Immunohistochemistry (IHC)
(Human Muscle )
Western Blot (WB)
(WB Suggested Anti-PAWR AntibodyPositive Control: Lane 1: 30ug rat striatum homogenatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Kristy Shimp, University of Florida)
Western Blot (WB)
(WB Suggested Anti-PAWR AntibodyPositive Control: Lane 1: 30ug rat striatum homogenatePrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Kristy Shimp, University of Florida)
Western Blot (WB)
(WB Suggested Anti-PAWR Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-PAWR Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-PAWR antibody
This is a rabbit polyclonal antibody against PAWR. It was validated on Western Blot and immunohistochemistry
Target Description: The tumor suppressor WT1 represses and activates transcription. Anti-Prostate Apoptosis Response Protein Par-4 (PAWR) is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
Target Description: The tumor suppressor WT1 represses and activates transcription. Anti-Prostate Apoptosis Response Protein Par-4 (PAWR) is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
Product Categories/Family for anti-PAWR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37kDa
NCBI Official Full Name
PRKC apoptosis WT1 regulator protein isoform 1
NCBI Official Synonym Full Names
pro-apoptotic WT1 regulator
NCBI Official Symbol
PAWR
NCBI Official Synonym Symbols
PAR4; Par-4
NCBI Protein Information
PRKC apoptosis WT1 regulator protein
Protein Family
NCBI Description
This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017]
Research Articles on PAWR
Similar Products
Product Notes
The PAWR (Catalog #AAA3200733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAWR antibody - middle region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAWR can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PAWR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VNIPAAECLD EYEDDEAGQK ERKREDAITQ QNTIQNEAVN LLDPGSSYLL. It is sometimes possible for the material contained within the vial of "PAWR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
