Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PARVASample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PARVA Polyclonal Antibody | anti-PARVA antibody

PARVA Antibody - N-terminal region

Gene Names
PARVA; MXRA2; CH-ILKBP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PARVA; Polyclonal Antibody; PARVA Antibody - N-terminal region; anti-PARVA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEG
Sequence Length
372
Applicable Applications for anti-PARVA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARVA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PARVASample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PARVASample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PARVA antibody
This is a rabbit polyclonal antibody against PARVA. It was validated on Western Blot

Target Description: This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.
Product Categories/Family for anti-PARVA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
Alpha-parvin
NCBI Official Synonym Full Names
parvin alpha
NCBI Official Symbol
PARVA
NCBI Official Synonym Symbols
MXRA2; CH-ILKBP
NCBI Protein Information
alpha-parvin
UniProt Protein Name
Alpha-parvin
Protein Family
UniProt Gene Name
PARVA
UniProt Synonym Gene Names
MXRA2
UniProt Entry Name
PARVA_HUMAN

NCBI Description

This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. [provided by RefSeq, Dec 2010]

Uniprot Description

PARVA: Probably plays a role in the regulation of cell adhesion and cytoskeleton organization. Plays a role in ciliogenesis. Interacts with TGFB1I1. Interacts with integrin-linked protein kinase and probably with actin and the LD1 and LD4 motifs of PXN. Interacts with ARHGAP31. Widely expressed, with highest levels in heart, skeletal muscle, kidney and liver. Belongs to the parvin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 11p15.3

Cellular Component: focal adhesion; lamellipodium; cytoplasm; plasma membrane; nucleus; Z disc; cytosol; actin cytoskeleton

Molecular Function: protein binding; actin binding

Biological Process: heterotypic cell-cell adhesion; regulation of cell shape; actin cytoskeleton reorganization; establishment and/or maintenance of cell polarity; sprouting angiogenesis

Research Articles on PARVA

Similar Products

Product Notes

The PARVA parva (Catalog #AAA3220077) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARVA Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARVA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PARVA parva for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPQKSPSVPK SPTPKSPPSR KKDDSFLGKL GGTLARRKKA KEVSELQEEG. It is sometimes possible for the material contained within the vial of "PARVA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.