Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Rabbit anti-Cattle Parathyroid Hormone Polyclonal Antibody | anti-PTHrP antibody

Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)

Gene Names
PTHLH; PTHrP
Reactivity
Cattle
Applications
Western Blot, Immunocytochemistry, Immunohistochemistry, ELISA
Purity
Affinity Chromatography
Synonyms
Parathyroid Hormone; Polyclonal Antibody; Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP); anti-PTHrP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cattle
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against PTHrP. It has beenselected for its ability to recognize PTHrP in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Liquid
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and S-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-AVSE HQLLHDKGKS IQDLRRRFFL HHLIAEIHTA EIRATSEVSP NSKPAPNTKN HPVRFGSDDE GKYLTQETNK VETYKEQPLK TPGKKKKSKP GKRKEQEKKK RRTRSAWLTS YVAGTGLEED
Applicable Applications for anti-PTHrP antibody
Western Blot (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) Formalin/Paraffin, ELISA (EIA)
Application Notes
Western blotting: 0.2-2ug/mL;1:250-2500
Immunohistochemistry: 5-20ug/mL;1:25-100
Immunocytochemistry: 5-20ug/mL;1:25-100
Optimal working dilutions must be determined by end user.
Fragment
PTHrP (Ala37~His177)
Organism Species
Bos taurus; Bovine (Cattle)
Cross Reactivity
Bovine
Conjugate
No Conjugate
Immunogen
Recombinant PTHrP (Ala37~His177) expressed in E Coli.
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2048026
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Recombinant protein.)

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,408 Da
NCBI Official Full Name
parathyroid hormone-related protein
NCBI Official Synonym Full Names
parathyroid hormone like hormone
NCBI Official Symbol
PTHLH
NCBI Official Synonym Symbols
PTHrP
NCBI Protein Information
parathyroid hormone-related protein
UniProt Protein Name
Parathyroid hormone-related protein
Protein Family
UniProt Gene Name
PTHLH
UniProt Synonym Gene Names
PTH-rP; PTHrP

Uniprot Description

Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath ().

Research Articles on PTHrP

Similar Products

Product Notes

The PTHrP pthlh (Catalog #AAA2026210) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Parathyroid Hormone Related Protein (PTHrP) reacts with Cattle and may cross-react with other species as described in the data sheet. AAA Biotech's Parathyroid Hormone can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) Formalin/Paraffin, ELISA (EIA). Western blotting: 0.2-2ug/mL;1:250-2500 Immunohistochemistry: 5-20ug/mL;1:25-100 Immunocytochemistry: 5-20ug/mL;1:25-100 Optimal working dilutions must be determined by end user. . Researchers should empirically determine the suitability of the PTHrP pthlh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and S-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-AVSE HQLLHDKGKS IQDLRRRFFL HHLIAEIHTA EIRATSEVSP NSKPAPNTKN HPVRFGSDDE GKYLTQETNK VETYKEQPLK TPGKKKKSKP GKRKEQEKKK RRTRSAWLTS YVAGTGLEED. It is sometimes possible for the material contained within the vial of "Parathyroid Hormone, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.