Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PALB2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellPALB2 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit anti-Human PALB2 Polyclonal Antibody | anti-PALB2 antibody

PALB2 antibody - N-terminal region

Gene Names
PALB2; FANCN; PNCA3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PALB2; Polyclonal Antibody; PALB2 antibody - N-terminal region; anti-PALB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLPGKSHPKRPNSQSQHTKTGLSSSILLYTPLNTVAPDDNDRPTTDMCSP
Sequence Length
590
Applicable Applications for anti-PALB2 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PALB2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellPALB2 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-PALB2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellPALB2 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-PALB2 antibody
This is a rabbit polyclonal antibody against PALB2. It was validated on Western Blot

Target Description: This gene encodes a protein that may function in tumor suppression. This protein binds to and colocalizes with the breast cancer 2 early onset protein (BRCA2) in nuclear foci and likely permits the stable intranuclear localization and accumulation of BRCA2.
Product Categories/Family for anti-PALB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
unnamed protein product
NCBI Official Synonym Full Names
partner and localizer of BRCA2
NCBI Official Symbol
PALB2
NCBI Official Synonym Symbols
FANCN; PNCA3
NCBI Protein Information
partner and localizer of BRCA2
UniProt Protein Name
Partner and localizer of BRCA2
UniProt Gene Name
PALB2
UniProt Synonym Gene Names
FANCN
UniProt Entry Name
PALB2_HUMAN

NCBI Description

This gene encodes a protein that may function in tumor suppression. This protein binds to and colocalizes with the breast cancer 2 early onset protein (BRCA2) in nuclear foci and likely permits the stable intranuclear localization and accumulation of BRCA2. [provided by RefSeq, Jul 2008]

Uniprot Description

PALB2: Plays a critical role in homologous recombination repair (HRR) through its ability to recruit BRCA2 and RAD51 to DNA breaks. Serves as the molecular scaffold in the formation of the BRCA1-PALB2-BRCA2 complex which is essential for homologous recombination. Strongly stimulates the DNA strand-invasion activity of RAD51, stabilizes the nucleoprotein filament against a disruptive BRC3-BRC4 polypeptide and helps RAD51 to overcome the suppressive effect of replication protein A (RPA). Functionally cooperates with RAD51AP1 in promoting of D-loop formation by RAD51. Essential partner of BRCA2 that promotes the localization and stability of BRCA2. Also enables its recombinational repair and checkpoint functions of BRCA2. May act by promoting stable association of BRCA2 with nuclear structures, allowing BRCA2 to escape the effects of proteasome-mediated degradation. Binds DNA with high affinity for D loop, which comprises single-stranded, double-stranded and branched DNA structures. Defects in PALB2 are a cause of susceptibility to breast cancer (BC). A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. Breast cancer susceptibility is strongly associated with PALB2 truncating mutations. Conversely, rare missense mutations do not strongly influence breast cancer risk (PubMed:22241545). Defects in PALB2 are the cause of Fanconi anemia complementation group N (FANCN). It is a disorder affecting all bone marrow elements and resulting in anemia, leukopenia and thrombopenia. It is associated with cardiac, renal and limb malformations, dermal pigmentary changes, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage) and defective DNA repair. Defects in PALB2 are the cause of pancreatic cancer type 3 (PNCA3). It is a malignant neoplasm of the pancreas. Tumors can arise from both the exocrine and endocrine portions of the pancreas, but 95% of them develop from the exocrine portion, including the ductal epithelium, acinar cells, connective tissue, and lymphatic tissue.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 16p12.2

Cellular Component: nucleoplasm

Molecular Function: protein binding; DNA binding

Biological Process: somitogenesis; organ morphogenesis; mesoderm development; DNA repair; inner cell mass cell proliferation; double-strand break repair via homologous recombination; negative regulation of apoptosis

Disease: Pancreatic Cancer, Susceptibility To, 3; Breast Cancer; Tracheoesophageal Fistula With Or Without Esophageal Atresia; Fanconi Anemia, Complementation Group N

Research Articles on PALB2

Similar Products

Product Notes

The PALB2 palb2 (Catalog #AAA3216164) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PALB2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PALB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PALB2 palb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLPGKSHPKR PNSQSQHTKT GLSSSILLYT PLNTVAPDDN DRPTTDMCSP. It is sometimes possible for the material contained within the vial of "PALB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.