Rabbit anti-Human, Mouse PACRG Polyclonal Antibody | anti-PACRG antibody

PACRG (GLUP, Parkin Coregulated Gene Protein, Molecular Chaperone/Chaperonin-binding Protein, PARK2 Coregulated Gene Protein, FLJ32724, HAK005771, PARK2CRG, RP3-495O10.2) (Biotin)

Cat. Num. AAA6388274

• Gene Names: PACRG; GLUP; PACRG2.1; PARK2CRG; HAK005771
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PACRG; Polyclonal Antibody; PACRG (GLUP; Parkin Coregulated Gene Protein; Molecular Chaperone/Chaperonin-binding Protein; PARK2 Coregulated Gene Protein; FLJ32724; HAK005771; PARK2CRG; RP3-495O10.2) (Biotin); anti-PACRG antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PACRG. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1572

• Applicable Applications for anti-PACRG antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PACRG, aa1-257 (NP_001073847.1).
• Immunogen Sequence: MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PACRG rabbit polyclonal antibody. Western Blot analysis of PACRG expression in human liver.)

Western Blot (WB)

(PACRG rabbit polyclonal antibody. Western Blot analysis of PACRG expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of PACRG expression in transfected 293T cell line by PACRG polyclonal antibody. Lane 1: PACRG transfected lysate (29.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PACRG antibody

Suppresses cell death induced by accumulation of unfolded Pael receptor (Pael-R, a substrate of Parkin). Facilitates the formation of inclusions consisting of Pael-R, molecular chaperones, protein degradation molecules and itself when proteasome is inhibited. May play an important role in the formation of Lewy bodies and protection of dopaminergic neurons against Parkinson disease.

Product Categories/Family for anti-PACRG antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 28279820
• NCBI GeneID: 135138
• NCBI Official Full Name: Homo sapiens PARK2 co-regulated, mRNA
• NCBI Official Synonym Full Names: parkin coregulated
• NCBI Official Symbol: PACRG
• NCBI Official Synonym Symbols: GLUP; PACRG2.1; PARK2CRG; HAK005771
• NCBI Protein Information: parkin coregulated gene protein
• Protein Family: PACRG-like protein

NCBI Description

This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]