Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Lung, respiratory epithelium)

Rabbit PA2G4 Polyclonal Antibody | anti-PA2G4 antibody

PA2G4 antibody - C-terminal region

Gene Names
PA2G4; EBP1; HG4-1; p38-2G4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PA2G4; Polyclonal Antibody; PA2G4 antibody - C-terminal region; anti-PA2G4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ
Sequence Length
394
Applicable Applications for anti-PA2G4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PA2G4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Lung, respiratory epithelium)

Immunohistochemistry (IHC) (Lung, respiratory epithelium)

Western Blot (WB)

(Host: RabbitTarget Name: PA2G4Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PA2G4Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PA2G4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePA2G4 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-PA2G4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePA2G4 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-PA2G4 antibody
This is a rabbit polyclonal antibody against PA2G4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
proliferation-associated protein 2G4
NCBI Official Synonym Full Names
proliferation-associated 2G4
NCBI Official Symbol
PA2G4
NCBI Official Synonym Symbols
EBP1; HG4-1; p38-2G4
NCBI Protein Information
proliferation-associated protein 2G4
UniProt Protein Name
Proliferation-associated protein 2G4
UniProt Gene Name
PA2G4
UniProt Synonym Gene Names
EBP1; hG4-1
UniProt Entry Name
PA2G4_HUMAN

NCBI Description

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Ebp1: May play a role in a ERBB3-regulated signal transduction pathway. Seems be involved in growth regulation. Acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). Inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. Binds RNA. Associates with 28S, 18S and 5.8S mature rRNAs, several rRNA precursors and probably U3 small nucleolar RNA. May be involved in regulation of intermediate and late steps of rRNA processing. May be involved in ribosome assembly. Mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). Belongs to the peptidase M24 family.

Protein type: Nucleolus; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 12q13.2

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleolus; nucleus; ribonucleoprotein complex

Molecular Function: protein binding; DNA binding; ubiquitin protein ligase binding; transcription factor activity

Biological Process: regulation of translation; cell proliferation; transcription, DNA-dependent; positive regulation of cell differentiation; negative regulation of transcription, DNA-dependent; cell cycle arrest; rRNA processing; negative regulation of apoptosis

Research Articles on PA2G4

Similar Products

Product Notes

The PA2G4 pa2g4 (Catalog #AAA3208657) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PA2G4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PA2G4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PA2G4 pa2g4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLQPFNVLYE KEGEFVAQFK FTVLLMPNGP MRITSGPFEP DLYKSEMEVQ. It is sometimes possible for the material contained within the vial of "PA2G4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.