Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using P4HTM antibody. Blue: DAPI for nuclear staining.)
Rabbit anti-Human P4HTM Polyclonal Antibody | anti-P4HTM antibody
P4HTM Polyclonal Antibody
Gene Names
P4HTM; PH4; PH-4; PHD4; EGLN4; HIFPH4; P4H-TM
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
P4HTM; Polyclonal Antibody; P4HTM Polyclonal Antibody; EGLN4; HIFPH4; P4H-TM; PH-4; PH4; PHD4; anti-P4HTM antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGTDSQP
Sequence Length
563
Applicable Applications for anti-P4HTM antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human P4HTM
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum membrane, Single-pass type II membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using P4HTM antibody. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using P4HTM antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-P4HTM antibody
The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and may be related to cellular oxygen sensing. Alternatively spliced variants encoding different isoforms have been identified.
Product Categories/Family for anti-P4HTM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47kDa/56kDa/63kDa
NCBI Official Full Name
transmembrane prolyl 4-hydroxylase isoform c
NCBI Official Synonym Full Names
prolyl 4-hydroxylase, transmembrane
NCBI Official Symbol
P4HTM
NCBI Official Synonym Symbols
PH4; PH-4; PHD4; EGLN4; HIFPH4; P4H-TM
NCBI Protein Information
transmembrane prolyl 4-hydroxylase
UniProt Protein Name
Transmembrane prolyl 4-hydroxylase
Protein Family
UniProt Gene Name
P4HTM
UniProt Synonym Gene Names
PH4; P4H-TM; HIF-PH4; HIF-prolyl hydroxylase 4; HPH-4
NCBI Description
The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and may be related to cellular oxygen sensing. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Uniprot Description
Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF1A at 'Pro-402' and 'Pro-564'. May function as a cellular oxygen sensor and, under normoxic conditions, may target HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
Research Articles on P4HTM
Similar Products
Product Notes
The P4HTM p4htm (Catalog #AAA9133628) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P4HTM Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's P4HTM can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the P4HTM p4htm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RQRVLRLTRL SPEIVELSEP LQVVRYGEGG HYHAHVDSGP VYPETICSHT KLVANESVPF ETSCRQVSPN WGLPSILRPG TPMTQAQPCT VGVPLGMGPG DHWVIPVSPW EHPQLGTCSV PPLPYSYMTV LFYLNNVTGG GETVFPVADN RTYDEMSLIQ DDVDLRDTRR HCDKGNLRVK PQQGTAVFWY NYLPDGQGWV GDVDDYSLHG GCLVTRGTKW IANNWINVDP SRARQALFQQ EMARLAREGG TDSQP. It is sometimes possible for the material contained within the vial of "P4HTM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
