Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)

Rabbit P450 Polyclonal Antibody | anti-P450 antibody

P450 antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
P450; Polyclonal Antibody; P450 antibody; Polyclonal P450; Anti-P450; P-450; POR; P 450; P450R; FLJ26468; DKFZp686G04235; Cytochrome Oxidoreductase; CPR; CYPOR; anti-P450 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of POR antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
517
Applicable Applications for anti-P450 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 2.5 ug/ml
IHC: 4-8 ug/ml
Biological Significance
POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
P450 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Immunohistochemistry (IHC)

(P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)

Immunohistochemistry (IHC) (P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)

Western Blot (WB)

(P450 antibody (MBS5301904) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (P450 antibody (MBS5301904) used at 2.5 ug/ml to detect target protein.)

Immunohistochemistry (IHC)

(P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)

Immunohistochemistry (IHC) (P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
Related Product Information for anti-P450 antibody
Rabbit polyclonal P450 antibody
Product Categories/Family for anti-P450 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
77 kDa (MW of target protein)
NCBI Official Full Name
P450
UniProt Protein Name
P450
Protein Family
UniProt Gene Name
p450
UniProt Entry Name
Q6F4F2_LOLRI

Similar Products

Product Notes

The P450 p450 (Catalog #AAA5301904) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P450 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P450 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 2.5 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the P450 p450 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "P450, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.