Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NCF4 expression in transfected 293T cell line by NCF4 polyclonal antibody. Lane 1: NCF4 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human p40 phox Polyclonal Antibody | anti-p40-phox antibody

p40 phox (Neutrophil Cytosolic Factor 4, NCF4, MGC3810, NCF, NCF-4, Neutrophil cytosol factor 4, Neutrophil NADPH oxidase factor 4, P40PHOX, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4) (Biotin)

Gene Names
NCF4; NCF; P40PHOX; SH3PXD4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
p40 phox; Polyclonal Antibody; p40 phox (Neutrophil Cytosolic Factor 4; NCF4; MGC3810; NCF; NCF-4; Neutrophil cytosol factor 4; Neutrophil NADPH oxidase factor 4; P40PHOX; p40-phox; SH3 and PX domain-containing protein 4; SH3PXD4) (Biotin); anti-p40-phox antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NCF4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-p40-phox antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NCF4, aa1-339 (NP_000622.2).
Immunogen Sequence
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NCF4 expression in transfected 293T cell line by NCF4 polyclonal antibody. Lane 1: NCF4 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NCF4 expression in transfected 293T cell line by NCF4 polyclonal antibody. Lane 1: NCF4 transfected lysate (39kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-p40-phox antibody
NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2(NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity.
Product Categories/Family for anti-p40-phox antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,032 Da
NCBI Official Full Name
neutrophil cytosol factor 4 isoform 1
NCBI Official Synonym Full Names
neutrophil cytosolic factor 4, 40kDa
NCBI Official Symbol
NCF4
NCBI Official Synonym Symbols
NCF; P40PHOX; SH3PXD4
NCBI Protein Information
neutrophil cytosol factor 4; NCF-4; p40-phox; neutrophil NADPH oxidase factor 4; SH3 and PX domain-containing protein 4
UniProt Protein Name
Neutrophil cytosol factor 4
UniProt Gene Name
NCF4
UniProt Synonym Gene Names
SH3PXD4; NCF-4; p40phox
UniProt Entry Name
NCF4_HUMAN

NCBI Description

The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

p40phox: a component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst. Upon neutrophil stimulation, this protein and other cytosolic elements are sent to the cell membrane from the cytosol to form a complex which produces phagocytic oxygen radicals. Responsible for the downregulation of NADPH-oxidase. Alternative splicing has been observed.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: membrane; endosome membrane; cytosol; NADPH oxidase complex

Molecular Function: protein dimerization activity; protein binding; superoxide-generating NADPH oxidase activator activity; phosphatidylinositol 3-phosphate binding

Biological Process: positive regulation of catalytic activity; interaction with host; antigen processing and presentation of peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I; immune response; vascular endothelial growth factor receptor signaling pathway

Disease: Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-positive, Type Iii

Research Articles on p40-phox

Similar Products

Product Notes

The p40-phox ncf4 (Catalog #AAA6388208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The p40 phox (Neutrophil Cytosolic Factor 4, NCF4, MGC3810, NCF, NCF-4, Neutrophil cytosol factor 4, Neutrophil NADPH oxidase factor 4, P40PHOX, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's p40 phox can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the p40-phox ncf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "p40 phox, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.