Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24498'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.12 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24498' and pd.language_id = 1
Query
Database
1.62 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24498'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
1.93 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24498'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24498' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24498'
⇄specificity => string (22) "Recognizes human ENO3."
$value['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (1214) "WB (Western Blot)||Western blot analysis of ENO3 over-expressed 293 cell lin...
$value['testing_protocols']
WB (Western Blot)||Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA24498_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.||AAA24498_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].||AAA24498_IF5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].||AAA24498_IHC4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].||AAA24498_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody. Lane 1: ENO3 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.||AAA24498_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (31.24kD).||AAA24498_WB.jpg
⇄⧉etc_term1 => string (220) "Immunogen||Partial recombinant corresponding to aa228-277 from human ENO3 (N...
$value['etc_term1']
Immunogen||Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG!!Conjugate||APC
⇄⧉products_references => string (1088) "1. The time course of the adaptations of human muscle proteome to bed rest a...
$value['products_references']
1. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, Pellegrino MA.J Physiol. 2012 Aug 6. 2. Functional analysis of beef tenderness. Guillemin N, Bonnet M, Jurie C, Picard B.J Proteomics. 2011 Aug 9. 3. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.BMC Cell Biol. 2011 May 10;12:18. 4. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315. 5. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.
⇄specificity => string (22) "Recognizes human ENO3."
$value->a['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->a['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value->a['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (1214) "WB (Western Blot)||Western blot analysis of ENO3 over-expressed 293 cell lin...
$value->a['testing_protocols']
WB (Western Blot)||Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA24498_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.||AAA24498_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].||AAA24498_IF5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].||AAA24498_IHC4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].||AAA24498_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody. Lane 1: ENO3 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.||AAA24498_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (31.24kD).||AAA24498_WB.jpg
⇄⧉etc_term1 => string (220) "Immunogen||Partial recombinant corresponding to aa228-277 from human ENO3 (N...
$value->a['etc_term1']
Immunogen||Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG!!Conjugate||APC
⇄⧉products_references => string (1088) "1. The time course of the adaptations of human muscle proteome to bed rest a...
$value->a['products_references']
1. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, Pellegrino MA.J Physiol. 2012 Aug 6. 2. Functional analysis of beef tenderness. Guillemin N, Bonnet M, Jurie C, Picard B.J Proteomics. 2011 Aug 9. 3. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.BMC Cell Biol. 2011 May 10;12:18. 4. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315. 5. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.
⇄specificity => string (22) "Recognizes human ENO3."
$value->d['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->d['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value->d['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (1214) "WB (Western Blot)||Western blot analysis of ENO3 over-expressed 293 cell lin...
$value->d['testing_protocols']
WB (Western Blot)||Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA24498_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.||AAA24498_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].||AAA24498_IF5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].||AAA24498_IHC4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].||AAA24498_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody. Lane 1: ENO3 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.||AAA24498_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (31.24kD).||AAA24498_WB.jpg
⇄⧉etc_term1 => string (220) "Immunogen||Partial recombinant corresponding to aa228-277 from human ENO3 (N...
$value->d['etc_term1']
Immunogen||Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG!!Conjugate||APC
⇄⧉products_references => string (1088) "1. The time course of the adaptations of human muscle proteome to bed rest a...
$value->d['products_references']
1. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, Pellegrino MA.J Physiol. 2012 Aug 6. 2. Functional analysis of beef tenderness. Guillemin N, Bonnet M, Jurie C, Picard B.J Proteomics. 2011 Aug 9. 3. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.BMC Cell Biol. 2011 May 10;12:18. 4. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315. 5. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.
⇄⧉products_description => string (823) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[0]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat AAV monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[0]['_source']['products_references']
⇄⧉products_related_diseases => string (226) "Nervous System Diseases||618!!Brain Diseases||506!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway||833822!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄sp_protein_name => string (14) "Protein S100-B"
$value[0]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[0]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (431) "aaa13137 rat no cross reaction with other factors typical testing data stand...
$value[0]['_source']['search_terms']
aaa13137 rat no cross reaction with other factors typical testing data standard curve for reference only aaa13137_sc elisa kit s100 calcium binding protein b s100b nef s100beta s 100 subunit beta chain neural 10,713 da s100b_human 12804681 aah01766.1 p04271 d3dsn6 176990 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision range20
⇄specificity => string (77) "Specifically recognize S100A7, no obvious cross reaction with other analogues"
$value[1]['_source']['specificity']
⇄purity => string (3) "N/A"
$value[1]['_source']['purity']
⇄form => string (3) "N/A"
$value[1]['_source']['form']
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[1]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Sandwich!!Samples||Serum, plasma, cell culture supernatant and other biological samples!!Detection Range||0.234-15ng/ml!!Sensitivity||0.141ng/ml
⇄⧉etc_term2 => string (270) "Intra-assay Precision||Intra-assay Precision: samples with low, medium and h...
$value[1]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision: samples with low, medium and high concentration are tested 20 times on same plate.!!Inter-assay Precision||Inter-assay Precision: samples with low, medium and high concentration are tested 20 times on three different plates.
⇄products_price => string (6) "0.0000"
$value[1]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[1]['_source']['products_weight']
⇄products_status => boolean true
$value[1]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[1]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "760"
$value[1]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[1]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[1]['_source']['language_id']
⇄products_name => string (31) "S100 Calcium Binding Protein A7"
⇄⧉products_name_syn => string (107) "S100A7/S100 Calcium Binding Protein A7/Protein S100-A7/Psoriasin/PSOR1/S100A...
$value[1]['_source']['products_name_syn']
S100A7/S100 Calcium Binding Protein A7/Protein S100-A7/Psoriasin/PSOR1/S100A7C/HID 5/HID5/HID-5/psoriasin 1
⇄products_gene_name => string (6) "S100A7"
$value[1]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[1]['_source']['products_gene_name_syn']
⇄⧉products_description => string (955) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[1]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti S100A7 antibody was pre-coated onto the 96-well plate. The biotin conjugated anti S100A7 antibody was used as the detection antibody. The standards and pilot samples were added to the wells subsequently. After incubation, unbound conjugates were removed by wash buffer. Then, biotinylated detection antibody was added to bind with S100A7 conjugated on coated antibody. After washing off unbound conjugates, HRP-Streptavidin was added. After a third washing, TMB substrates were added to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that turned yellow after adding a stop solution. Read the O.D. absorbance at 450nm in a microplate reader. The concentration of S100A7 in the sample was calculated by drawing a standard curve. The concentration of the target substance is proportional to the OD450 value.
⇄⧉search_terms => string (506) "aaa17539 mouse this assay has high sensitivity and excellent specificity for...
$value[1]['_source']['search_terms']
aaa17539 mouse this assay has high sensitivity and excellent specificity for detection of s100a4 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17539_sc elisa kit s100 calcium binding protein a7 s100a7 psoriasin psor1 s100a7c hid 5 hid5 1 11,471 da s10a7_human 21961601 aah34687.1 p31151 q5sy67 q6fge3 q9h1e2 600353 samples serum plasma tissue homogenates other biological fluids type sandwich range 15.6 1000pg ml hid51
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of S...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of S100B. No significant cross-reactivity or interference between S100B and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[2]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
S100B (Protein S100-B)/S100/S100 beta/S100 calcium binding protein B/S100 calcium-binding protein B/S100 calcium-binding protein; beta (neural)/S-100 calcium-binding protein; beta chain; 10/S-100 protein beta chain/S-100 protein subunit beta/S100beta
⇄products_gene_name => string (5) "S100B"
$value[2]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[2]['_source']['products_gene_name_syn']
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[2]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||722!!Brain Diseases||600!!Cardiovascular Diseases||...
$value[2]['_source']['products_related_diseases']
Nervous System Diseases||722!!Brain Diseases||600!!Cardiovascular Diseases||264!!Brain Injuries||220!!Inflammation||160!!Disease Models, Animal||127!!Hemorrhage||87!!Heart Diseases||77!!Necrosis||67!!Cognition Disorders||51
⇄products_categories => string (3) "N/A"
$value[2]['_source']['products_categories']
⇄ncbi_full_name => string (30) "S100 calcium binding protein B"
$value[2]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (30) "S100 calcium binding protein B"
Activated TLR4 Signalling Pathway||1269236!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||1269258!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||1269268!!DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway||1269276!!Immune System Pathway||1269170!!Innate Immune System Pathway||1269203!!MyD88 Cascade Initiated On Plasma Membrane Pathway||1269207!!MyD88 Dependent Cascade Initiated On Endosome Pathway||1269228!!MyD88-independent TLR3/TLR4 Cascade Pathway||1269220!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||1269237
⇄sp_protein_name => string (14) "Protein S100-B"
$value[2]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[2]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (533) "aaa17705 rat this assay has high sensitivity and excellent specificity for d...
$value[2]['_source']['search_terms']
aaa17705 rat this assay has high sensitivity and excellent specificity for detection of s100b no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17705_sc elisa kit s100 calcium binding protein b beta neural s 100 chain 10 subunit s100beta nef 10,713 da s100b_human 12804681 aah01766.1 p04271 d3dsn6 176990 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 62.5 4000pg ml 37.5pg intra precision cv chain10
⇄⧉etc_term1 => string (158) "Samples||Serum, Plasma, Cell Culture Supernatants, Body Fluid And Tissue Hom...
$value[3]['_source']['etc_term1']
Samples||Serum, Plasma, Cell Culture Supernatants, Body Fluid And Tissue Homogenate!!Assay Type||Quantitative Competitive or Sandwich!!Sensitivity||0.1 ng/mL.
⇄etc_term2 => string (3) "N/A"
$value[3]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[3]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[3]['_source']['products_weight']
⇄products_status => boolean true
$value[3]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[3]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[3]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[3]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[3]['_source']['language_id']
⇄products_name => string (31) "S100 Calcium Binding Protein A9"
⇄⧉products_description => string (1475) "Intended Uses: This S100A9 ELISA kit is a 1.5 hour solid-phase ELISA designe...
$value[3]['_source']['products_description']
Intended Uses: This S100A9 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human S100A9. This ELISA kit for research use only!<br><br>Principle of the Assay: S100A9 ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for S100A9. Standards or samples are then added to the microtiter plate wells and S100A9 if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of S100A9 present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for S100A9 are added to each well to "sandwich" the S100A9 immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain S100A9 and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The S100A9 concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (552) "aaa16513 mouse typical testing data standard curve for reference only aaa165...
$value[3]['_source']['search_terms']
aaa16513 mouse typical testing data standard curve for reference only aaa16513_sc elisa kit s100 calcium binding protein a9 s100a9 partial 13,242 da calgranulin b calprotectin l1h subunit leukocyte l1 complex heavy chain migration inhibitory factor related 14 mrp p14 cagb cfag mrp14 s10a9_human 49457442 cag47020.1 p06702 q6fga1 q9nym0 q9ucj1 d3dv36 123886 signal transduction samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive or sandwich sensitivity 0.1 ng ml related14 sensitivity0.1
⇄⧉specificity => string (179) "This assay has high sensitivity and excellent specificity for detection of d...
$value[4]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of dog S100B. No significant cross-reactivity or interference between dog S100B and analogues was observed.
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[4]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[4]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[4]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[4]['_source']['products_weight']
⇄products_status => boolean true
$value[4]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[4]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[4]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[4]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[4]['_source']['language_id']
⇄products_name => string (30) "S100 calcium binding protein P"
⇄⧉products_name_syn => string (151) "Human S100 calcium binding protein P (S100P) ELISA Kit; MIG9; S100 calcium-b...
$value[4]['_source']['products_name_syn']
Human S100 calcium binding protein P (S100P) ELISA Kit; MIG9; S100 calcium-binding protein P; migration-inducing gene 9; S100 calcium binding protein P
⇄products_gene_name => string (5) "S100P"
$value[4]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[4]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[4]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S100B has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S100B present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S100B is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S100B bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (536) "aaa15248 human this assay has high sensitivity and excellent specificity for...
$value[4]['_source']['search_terms']
aaa15248 human this assay has high sensitivity and excellent specificity for detection of dog s100b no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15248_td elisa kit s100 calcium binding protein p s100p mig9 migration inducing gene 9 e 10,400 da s100e s100p_human 5174663 np_005971.1 p25815 nm_005980.2 q5j7w2 600614 samples serum plasma tissue homogenates type quantitative sandwich range 39 pg ml 2500 9.8 intra precision within an cv gene9 range39
⇄⧉etc_term1 => string (211) "Samples||Human Serum, Plasma Or Cell Culture Supernatant And Organizations I...
$value[5]['_source']['etc_term1']
Samples||Human Serum, Plasma Or Cell Culture Supernatant And Organizations In The Natural And Recombinant Rve1 Concentration!!Assay Type||Sandwich!!Detection Range||20 ng/ml-0.312 ng/ml!!Sensitivity||0.06 ng/ml.
⇄⧉products_description => string (675) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[5]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is human RvE1 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_references => string (3) "N/A"
$value[5]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[5]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[5]['_source']['products_categories']
⇄ncbi_full_name => string (32) "S100 calcium-binding protein A15"
⇄⧉search_terms => string (475) "aaa13189 human no cross reaction with other factors typical testing data sta...
$value[5]['_source']['search_terms']
aaa13189 human no cross reaction with other factors typical testing data standard curve for reference only aaa13189_sc elisa kit s100 calcium binding protein a15 s100a15 12,870 da a15a a7a s100a15a s100a7 s100a7a s115a_mouse 39939487 aar32783.1 samples serum plasma or cell culture supernatant and organizations in the natural recombinant rve1 concentration assay type sandwich detection range 20 ng ml 0.312 sensitivity 0.06 intra precision <= 8 inter 12 range20 <=8 inter12
⇄products_name => string (38) "S100 Calcium Binding Protein B (S100B)"
$value[6]['_source']['products_name']
⇄products_name_oem => string (54) "Human S100 Calcium Binding Protein B (S100B) ELISA Kit"
$value[6]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[6]['_source']['products_name_syn']
⇄products_gene_name => string (5) "S100B"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[6]['_source']['products_gene_name_syn']
⇄⧉products_description => string (676) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[6]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is human S100B monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Nervous System Diseases||525!!Brain Diseases||435!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway||833822!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄sp_protein_name => string (14) "Protein S100-B"
$value[6]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[6]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (414) "aaa12875 human no cross reaction with other factors typical standard curve t...
$value[6]['_source']['search_terms']
aaa12875 human no cross reaction with other factors typical standard curve testing data aaa12875_td elisa kit s100 calcium binding protein b s100b nef s100beta s 100 subunit beta chain neural 10,713 da s100b_human 12804681 aah01766.1 p04271 d3dsn6 176990 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision range10
⇄products_name => string (38) "S100 Calcium Binding Protein B (S100B)"
$value[7]['_source']['products_name']
⇄products_name_oem => string (54) "Mouse S100 Calcium Binding Protein B (S100B) ELISA Kit"
$value[7]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[7]['_source']['products_name_syn']
⇄products_gene_name => string (5) "S100B"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (676) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[7]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Mouse S100B monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_references => string (3) "N/A"
$value[7]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Nervous System Diseases||525!!Brain Diseases||435!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway||833822!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄sp_protein_name => string (14) "Protein S100-B"
$value[7]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[7]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (408) "aaa12482 mouse no cross reaction with other factors typical standard curve t...
$value[7]['_source']['search_terms']
aaa12482 mouse no cross reaction with other factors typical standard curve testing data aaa12482_td elisa kit s100 calcium binding protein b s100b nef s100beta s 100 subunit beta chain neural 10,713 da s100b_human 12804681 aah01766.1 p04271 d3dsn6 176990 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision to5
⇄⧉etc_term1 => string (209) "Samples||Rat Serum, Plasma Or Cell Culture Supernatant And Organizations In ...
$value[8]['_source']['etc_term1']
Samples||Rat Serum, Plasma Or Cell Culture Supernatant And Organizations In The Natural And Recombinant S100 Concentration!!Assay Type||Sandwich!!Detection Range||20 ng/ml-0.312 ng/ml!!Sensitivity||0.06 ng/ml.
⇄products_name => string (38) "S100 Calcium Binding Protein B (S100B)"
$value[8]['_source']['products_name']
⇄products_name_oem => string (52) "Rat S100 Calcium Binding Protein B (S100B) ELISA Kit"
$value[8]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[8]['_source']['products_name_syn']
⇄products_gene_name => string (5) "S100B"
$value[8]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[8]['_source']['products_gene_name_syn']
⇄⧉products_description => string (673) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[8]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Rat S100 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_references => string (3) "N/A"
$value[8]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Nervous System Diseases||525!!Brain Diseases||435!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway||833822!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄sp_protein_name => string (14) "Protein S100-B"
$value[8]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[8]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (471) "aaa12579 rat no cross reaction with other factors typical testing data stand...
$value[8]['_source']['search_terms']
aaa12579 rat no cross reaction with other factors typical testing data standard curve for reference only aaa12579_sc elisa kit s100 calcium binding protein b s100b nef s100beta s 100 subunit beta chain neural 10,713 da s100b_human 12804681 aah01766.1 p04271 d3dsn6 176990 samples serum plasma or cell culture supernatant and organizations in the natural recombinant concentration assay type sandwich detection range 20 ng ml 0.312 sensitivity 0.06 intra precision range20
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of r...
$value[9]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat S-100B. No significant cross-reactivity or interference between rat S-100B and analogues was observed.
⇄purity => string (3) "N/A"
$value[9]['_source']['purity']
⇄form => string (3) "N/A"
$value[9]['_source']['form']
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[9]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[9]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[9]['_source']['products_weight']
⇄products_status => boolean true
$value[9]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[9]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[9]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[9]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[9]['_source']['language_id']
⇄products_name => string (30) "S100 calcium binding protein B"
⇄⧉products_description => string (740) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[9]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S-100B has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S-100B present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S-100B is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S-100B bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄⧉products_related_diseases => string (226) "Nervous System Diseases||616!!Brain Diseases||503!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DAI Mediated Induction Of Type I IFNs Pathway||576256!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Initiated On Plasma Membrane Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄sp_protein_name => string (14) "Protein S100-B"
$value[9]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[9]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (681) "aaa15374 rat this assay has high sensitivity and excellent specificity for d...
$value[9]['_source']['search_terms']
aaa15374 rat this assay has high sensitivity and excellent specificity for detection of pig s 100b no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15374_td elisa kit s100 calcium binding protein b soluble nef s100beta otthump00000174958 100 beta chain neural protei s100b subunit 10,713 da s100b_rabit 164414447 np_001076199.1 q6ynr6 nm_001082730.1 samples serum plasma tissue homogenates type quantitative sandwich range 78 pg ml 5000 19.5 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in otthump00000174958100 range78
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of r...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat S-100B. No significant cross-reactivity or interference between rat S-100B and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[10]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[10]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[10]['_source']['products_weight']
⇄products_status => boolean true
$value[10]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[10]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[10]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[10]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[10]['_source']['language_id']
⇄products_name => string (38) "S100 calcium binding protein B (S100B)"
⇄⧉products_name_syn => string (92) "Dog S100 calcium binding protein B (S100B) ELISA kit; S100 calcium binding p...
$value[10]['_source']['products_name_syn']
Dog S100 calcium binding protein B (S100B) ELISA kit; S100 calcium binding protein B (S100B)
⇄products_gene_name => string (5) "S100B"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[10]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S-100B has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S-100B present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S-100B is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S-100B bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[10]['_source']['products_references']
⇄⧉products_related_diseases => string (237) "Nervous System Diseases||463!!Brain Diseases||384!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DAI Mediated Induction Of Type I IFNs Pathway||576256!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Initiated On Plasma Membrane Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄sp_protein_name => string (14) "Protein S100-B"
$value[10]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[10]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (545) "aaa18047 dog this assay has high sensitivity and excellent specificity for d...
$value[10]['_source']['search_terms']
aaa18047 dog this assay has high sensitivity and excellent specificity for detection of rat s 100b no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18047_td elisa kit s100 calcium binding protein b s100b nef s100beta 100 subunit beta chain neural 10,713 da s100b_human 5454034 np_006263.1 p04271 nm_006272.2 d3dsn6 176990 samples serum plasma tissue homogenates type quantitative sandwich range 3.12 pg ml 200 0.78 intra precision within an cv s100beta100 ml200
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of h...
$value[11]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human S100A11. No significant cross-reactivity or interference between human S100A11 and analogues was observed.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[11]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[11]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[11]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[11]['_source']['products_weight']
⇄products_status => boolean true
$value[11]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[11]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[11]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[11]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[11]['_source']['language_id']
⇄products_name => string (32) "S100 calcium binding protein A11"
Human S100 Calcium Binding Protein A11 (S100A11) ELISA Kit; MLN70; S100C; S100 calcium-binding protein A11 (calgizzarin) ; calgizzarin; S100 calcium binding protein A11
⇄products_gene_name => string (7) "S100A11"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (743) "Principle of the Assay||This assay employs the quantitative sandwich enzyme ...
$value[11]['_source']['products_description']
Principle of the Assay||This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S100A11 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S100A11 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S100A11 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S100A11 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_protein_info => string (176) "protein S100-A11; MLN 70; calgizzarin; protein S100-C; epididymis secretory ...
$value[11]['_source']['ncbi_protein_info']
protein S100-A11; MLN 70; calgizzarin; protein S100-C; epididymis secretory protein Li 43; metastatic lymph node gene 70 protein; S100 calcium-binding protein A11 (calgizzarin)
⇄⧉sp_protein_name_syn => string (181) "Calgizzarin; Metastatic lymph node gene 70 protein; MLN 70; Protein S100-C; ...
$value[11]['_source']['sp_protein_name_syn']
Calgizzarin; Metastatic lymph node gene 70 protein; MLN 70; Protein S100-C; S100 calcium-binding protein A11Cleaved into the following chain:Protein S100-A11, N-terminally processed
⇄sp_gene_name => string (7) "S100A11"
$value[11]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (20) "MLN70; S100C; MLN 70"
⇄⧉search_terms => string (586) "aaa15736 human this assay has high sensitivity and excellent specificity for...
$value[11]['_source']['search_terms']
aaa15736 human this assay has high sensitivity and excellent specificity for detection of s100a11 no significant cross reactivity or interference between analogues was observed elisa kit s100 calcium binding protein a11 mln70 s100c calgizzarin hel s 43 mln 70 c epididymis secretory li metastatic lymph node gene 11,740 da a11cleaved into the following chain:protein n terminally processed s10ab_human 5032057 np_005611.1 p31949 nm_005620.1 q5vtk0 603114 samples serum plasma tissue homogenates cell lysates type sandwich range 0.156 ng ml 10 0.039 intra precision within an cv s43 ml10
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of r...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat S100A8. No significant cross-reactivity or interference between rat S100A8 and analogues was observed.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[12]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[12]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[12]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[12]['_source']['products_weight']
⇄products_status => boolean true
$value[12]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[12]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[12]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[12]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[12]['_source']['language_id']
⇄products_name => string (31) "S100 calcium binding protein A9"
human S100 calcium binding protein A9/calgranulin B; S100A9 ELISA Kit; 60B8AG; CAGB; CFAG; CGLB; L1AG; LIAG; MAC387; MIF; MRP14; NIF; P14; S100 calcium-binding protein A9; S100 calcium-binding protein A9 (calgranulin B) ; calgranulin B; S100 calcium binding protein A9
⇄products_gene_name => string (6) "S100A9"
$value[12]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[12]['_source']['products_gene_name_syn']
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[12]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S100A8 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S100A8 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S100A8 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S100A8 bound in the initial step. The color development is stopped and the intensity of the color is measured.
protein S100-A9; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B)
⇄⧉search_terms => string (687) "aaa15004 human this assay has high sensitivity and excellent specificity for...
$value[12]['_source']['search_terms']
aaa15004 human this assay has high sensitivity and excellent specificity for detection of rat s100a8 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15004_td elisa kit s100 calcium binding protein a9 calgranulin b s100a9 60b8ag cagb cfag cglb l1ag liag mac387 mif mrp14 nif p14 mrp 14 calprotectin l1h subunit leukocyte l1 complex heavy chain migration inhibitory factor related 13,242 da s10a9_human 4506773 np_002956.1 p06702 nm_002965.3 q6fga1 q9nym0 q9ucj1 d3dv36 123886 samples serum plasma tissue homogenates type quantitative sandwich range 3.12 ng ml 200 0.78 intra precision within an cv ml200
⇄⧉specificity => string (189) "This assay has high sensitivity and excellent specificity for detection of c...
$value[13]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of canine S100A12. No significant cross-reactivity or interference between canine S100A12 and analogues was observed.
⇄purity => string (3) "N/A"
$value[13]['_source']['purity']
⇄form => string (3) "N/A"
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[13]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[13]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[13]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[13]['_source']['products_weight']
⇄products_status => boolean true
$value[13]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[13]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[13]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[13]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[13]['_source']['language_id']
⇄products_name => string (32) "S100 calcium binding protein A12"
Human S100 calcium binding protein A12/Calgranulin-C (S100A12) ELISA Kit; CAAF1; CAGC; CGRP; ENRAGE; MRP6; p6; S100 calcium-binding protein A12; S100 calcium-binding protein A12 (calgranulin C) ; calgranulin C; S100 calcium binding protein A12
⇄products_gene_name => string (7) "S100A12"
$value[13]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[13]['_source']['products_gene_name_syn']
⇄⧉products_description => string (743) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[13]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S100A12 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S100A12 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S100A12 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S100A12 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[13]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Inflammation||163!!Immune System Diseases||47!!Gastrointestinal Diseases||43...
Inflammation||163!!Immune System Diseases||47!!Gastrointestinal Diseases||43!!Cardiovascular Diseases||38!!Necrosis||25!!Atherosclerosis||20!!Diabetes Mellitus||11!!Nervous System Diseases||11!!Bone Diseases||8!!Carcinoma||7
⇄products_categories => string (3) "N/A"
$value[13]['_source']['products_categories']
⇄ncbi_full_name => string (16) "protein S100-A12"
$value[13]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (32) "S100 calcium binding protein A12"
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway||833822!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄⧉sp_protein_name_syn => string (300) "CGRP; Calcium-binding protein in amniotic fluid 1; CAAF1; Calgranulin-C; CAG...
$value[13]['_source']['sp_protein_name_syn']
CGRP; Calcium-binding protein in amniotic fluid 1; CAAF1; Calgranulin-C; CAGC; Extracellular newly identified RAGE-binding protein; EN-RAGE; Migration inhibitory factor-related protein 6; MRP-6; p6; Neutrophil S100 protein; S100 calcium-binding protein A12Cleaved into the following chain:Calcitermin
⇄⧉search_terms => string (742) "aaa15331 human this assay has high sensitivity and excellent specificity for...
$value[13]['_source']['search_terms']
aaa15331 human this assay has high sensitivity and excellent specificity for detection of canine s100a12 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15331_td elisa kit s100 calcium binding protein a12 calgranulin c caaf1 cagc cgrp enrage mrp6 p6 mrp 6 en rage neutrophil in amniotic fluid 1 migration inhibitory factor related extracellular newly identified 10,575 da a12cleaved into the following chain:calcitermin s10ac_human 5032059 np_005612.1 p80511 nm_005621.1 p83219 q5sy66 q7m4r1 603112 samples serum plasma cell culture supernates tissue homogenates type quantitative sandwich range 0.625 ng ml 40 0.156 intra precision within an cv fluid1 ml40
⇄⧉specificity => string (382) "This assay has high sensitivity and excellent specificity for detection of S...
$value[14]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of S100A9. No significant cross-reactivity or interference between S100A9 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between S100A9 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[14]['_source']['purity']
⇄form => string (3) "N/A"
$value[14]['_source']['form']
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉etc_term1 => string (157) "Samples||Serum, plasma, cell culture supernatants, body fluid and tissue hom...
$value[14]['_source']['etc_term1']
Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Assay Type||Quantitative Competitive or Sandwich!!Sensitivity||0.1 ng/mL
⇄etc_term2 => string (3) "N/A"
$value[14]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[14]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[14]['_source']['products_weight']
⇄products_status => boolean true
$value[14]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[14]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[14]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[14]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[14]['_source']['language_id']
⇄products_name => string (31) "S100 Calcium Binding Protein A9"
⇄⧉products_description => string (1517) "Intended Uses: This S100A9 ELISA kit is a 1.5 hour solid-phase ELISA designe...
$value[14]['_source']['products_description']
Intended Uses: This S100A9 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human S100A9. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: S100A9 ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for S100A9. Standards or samples are then added to the microtiter plate wells and S100A9 if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of S100A9 present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for S100A9 are added to each well to "sandwich" the S100A9 immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain S100A9 and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The S100A9 concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (804) "aaa16037 human this assay has high sensitivity and excellent specificity for...
$value[14]['_source']['search_terms']
aaa16037 human this assay has high sensitivity and excellent specificity for detection of s100a9 no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16037_sc elisa kit s100 calcium binding protein a9 partial 13,242 da calgranulin b calprotectin l1h subunit leukocyte l1 complex heavy chain migration inhibitory factor related 14 mrp p14 cagb cfag mrp14 s10a9_human 49457442 cag47020.1 p06702 q6fga1 q9nym0 q9ucj1 d3dv36 123886 signal transduction samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive sandwich 0.1 ng ml related14 sandwich0.1
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of m...
$value[15]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse S100B. No significant cross-reactivity or interference between mouse S100B and analogues was observed.
⇄purity => string (3) "N/A"
$value[15]['_source']['purity']
⇄form => string (3) "N/A"
$value[15]['_source']['form']
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[15]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[15]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%.Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[15]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[15]['_source']['products_weight']
⇄products_status => boolean true
$value[15]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[15]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[15]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[15]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[15]['_source']['language_id']
⇄products_name => string (30) "S100 calcium binding protein B"
$value[15]['_source']['products_name']
⇄products_name_oem => string (37) "Mouse Protein S100-B, S100B ELISA Kit"
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[15]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S100B has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S100B present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S100B is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S100B bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (237) "Nervous System Diseases||463!!Brain Diseases||384!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||575140!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||575162!!DAI Mediated Induction Of Type I IFNs Pathway||575163!!Immune System Pathway||575095!!Innate Immune System Pathway||575115!!MyD88 Cascade Initiated On Plasma Membrane Pathway||575118!!MyD88 Dependent Cascade Initiated On Endosome Pathway||575135!!MyD88-independent Cascade Initiated On Plasma Membrane Pathway||575142!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||575141!!NFkB And MAP Kinases Activation Mediated By TLR4 Signaling Repertoire Pathway||575144
⇄sp_protein_name => string (14) "Protein S100-B"
$value[15]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[15]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄sp_gene_name => string (5) "S100b"
$value[15]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[15]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (11) "S100B_MOUSE"
$value[15]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[15]['_source']['sp_mim']
⇄sp_interactions => string (8) "Stat1||2"
$value[15]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[15]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[15]['_source']['products_viewed']
⇄⧉search_terms => string (680) "aaa18039 mouse this assay has high sensitivity and excellent specificity for...
$value[15]['_source']['search_terms']
aaa18039 mouse this assay has high sensitivity and excellent specificity for detection of s100b no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18039_td elisa kit s100 calcium binding protein b nef s100beta otthump00000174958 s 100 beta chain neural protei polypeptide bpb ai850290 subunit 10,728 da s100b_mouse 6677839 np_033141.1 p50114 nm_009115.3 samples serum plasma tissue homogenates type quantitative sandwich range 3.12 pg ml 200 typically less than 0.78 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml200
⇄⧉specificity => string (185) "This assay has high sensitivity and excellent specificity for detection of h...
$value[16]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human S100A4. No significant cross-reactivity or interference between human S100A4 and analogues was observed.
⇄purity => string (3) "N/A"
$value[16]['_source']['purity']
⇄form => string (3) "N/A"
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[16]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[16]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[16]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[16]['_source']['products_weight']
⇄products_status => boolean true
$value[16]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[16]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[16]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[16]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[16]['_source']['language_id']
⇄products_name => string (31) "S100 calcium binding protein A4"
$value[16]['_source']['products_name']
⇄products_name_oem => string (39) "Human Protein S100-A4, S100A4 ELISA Kit"
Human Protein S100-A4 (S100A4) ELISA kit; 18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98; OTTHUMP00000015469; OTTHUMP00000032895; S100 calcium binding protein A4 (calcium protein; calvasculin; metastasin; murine placental homolog) ; S100 calcium-bind; S100 calcium binding protein A4
⇄products_gene_name => string (6) "S100A4"
$value[16]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[16]['_source']['products_gene_name_syn']
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[16]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S100A4 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S100A4 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S100A4 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S100A4 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (764) "aaa18131 human this assay has high sensitivity and excellent specificity for...
$value[16]['_source']['search_terms']
aaa18131 human this assay has high sensitivity and excellent specificity for detection of s100a4 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18131_td elisa kit s100 calcium binding protein a4 18a2 42a capl fsp1 mts1 p9ka pel98 otthump00000015469 otthump00000032895 calvasculin metastasin murine placental homolog bind fibroblast specific 1 malignant transformation suppression leukemia multidrug resistance associated 11,729 da s10a4_human 4506765 np_002952.1 p26447 nm_002961.2 q6icp8 a8k7r8 d3dv46 114210 samples serum plasma cell culture supernates tissue homogenates type sandwich quantitative range 0.9 ng ml 60 0.225 intra precision within an cv specific1 range0.9 ml60
⇄⧉specificity => string (379) "This assay has high sensitivity and excellent specificity for detection of S...
$value[17]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of S100B. No significant cross-reactivity or interference between S100B and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between S100B and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[17]['_source']['purity']
⇄form => string (3) "N/A"
$value[17]['_source']['form']
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉etc_term1 => string (157) "Samples||Serum, plasma, cell culture supernatants, body fluid and tissue hom...
$value[17]['_source']['etc_term1']
Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Assay Type||Quantitative Competitive or Sandwich!!Sensitivity||0.1 ng/mL
⇄etc_term2 => string (3) "N/A"
$value[17]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[17]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[17]['_source']['products_weight']
⇄products_status => boolean true
$value[17]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[17]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[17]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[17]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[17]['_source']['language_id']
⇄products_name => string (30) "S100 Calcium Binding Protein B"
$value[17]['_source']['products_name']
⇄products_name_oem => string (46) "Human S100 Calcium Binding Protein B ELISA Kit"
$value[17]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[17]['_source']['products_name_syn']
⇄products_gene_name => string (5) "S100B"
$value[17]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[17]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1507) "Intended Uses: This S100B ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[17]['_source']['products_description']
Intended Uses: This S100B ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human S100B. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: S100B ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for S100B. Standards or samples are then added to the microtiter plate wells and S100B if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of S100B present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for S100B are added to each well to "sandwich" the S100B immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain S100B and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The S100B concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[17]['_source']['products_references']
⇄⧉products_related_diseases => string (226) "Nervous System Diseases||618!!Brain Diseases||505!!Cardiovascular Diseases||...
Activated TLR4 Signalling Pathway||106400!!Advanced Glycosylation Endproduct Receptor Signaling Pathway||187092!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway||833822!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!MyD88 Cascade Initiated On Plasma Membrane Pathway||205107!!MyD88 Dependent Cascade Initiated On Endosome Pathway||187081!!MyD88-independent Cascade Pathway||106401!!MyD88:Mal Cascade Initiated On Plasma Membrane Pathway||106390
⇄sp_protein_name => string (14) "Protein S100-B"
$value[17]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding p...
$value[17]['_source']['sp_protein_name_syn']
S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
⇄⧉search_terms => string (673) "aaa15974 human this assay has high sensitivity and excellent specificity for...
$value[17]['_source']['search_terms']
aaa15974 human this assay has high sensitivity and excellent specificity for detection of s100b no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa15974_sc elisa kit s100 calcium binding protein b nef s100beta s 100 subunit beta chain neural 10,713 da s100b_human 49457242 cag46920.1 p04271 d3dsn6 176990 signal transduction samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive sandwich 0.1 ng ml sandwich0.1
⇄⧉specificity => string (137) "This assay has high sensitivity for detection of S100A4. 100% cross-reactivi...
$value[18]['_source']['specificity']
This assay has high sensitivity for detection of S100A4. 100% cross-reactivity of S100A4 was observed among human, mouse and rat samples.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (474) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[18]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition.<br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Samples||Serum, Plasma, Tissue Homogenates, Cell Lysates, Cell Culture Supernates And Other Biological Fluids!!Assay Type||Quantitative Sandwich!!Detection Range||0.156-10ng/mL!!Sensitivity||0.058ng/mL.
⇄⧉etc_term2 => string (418) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level S100A4 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level S100A4 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄products_price => string (6) "0.0000"
$value[18]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[18]['_source']['products_weight']
⇄products_status => boolean true
$value[18]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[18]['_source']['products_tax_class_id']
⇄manufacturers_id => string (4) "2700"
$value[18]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[18]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[18]['_source']['language_id']
⇄products_name => string (40) "S100 Calcium Binding Protein A7 (S100A7)"
⇄⧉products_description => string (1153) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[18]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of S100A4 in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Due to the high homology of the sequence among different species, the kit can be used to detect human, mouse and rat samples.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to S100A4. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to S100A4. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain S100A4, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of S100A4 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (617) "aaa23024 human this assay has high sensitivity for detection of s100a4 100 c...
$value[18]['_source']['search_terms']
aaa23024 human this assay has high sensitivity for detection of s100a4 100 cross reactivity was observed among mouse and rat samples typical testing data standard curve reference only aaa23024_sc elisa kit s100 calcium binding protein a7 s100a7 psor1 s100a7c psoriasin 1 11,471 da 21961601 aah34687.1 p31151 q5sy67 q6fge3 q9h1e2 m86757 mrna serum plasma tissue homogenates cell lysates culture supernates other biological fluids type quantitative sandwich range 0.156 10ng ml 0.058ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv s100a4100 psoriasin1 an3 tested20
⇄⧉specificity => string (185) "This assay has high sensitivity and excellent specificity for detection of h...
$value[19]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human S100A8. No significant cross-reactivity or interference between human S100A8 and analogues was observed.
⇄purity => string (3) "N/A"
$value[19]['_source']['purity']
⇄form => string (3) "N/A"
$value[19]['_source']['form']
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[19]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[19]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[19]['_source']['products_weight']
⇄products_status => boolean true
$value[19]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[19]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[19]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[19]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[19]['_source']['language_id']
⇄products_name => string (31) "S100 calcium binding protein A8"
$value[19]['_source']['products_name']
⇄products_name_oem => string (69) "human S100 calcium binding protein A8/calgranulin A, S100A8 ELISA Kit"
human S100 calcium binding protein A8/calgranulin A; S100A8 ELISA Kit; 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8; OTTHUMP00000015330; S100 calcium-binding protein A8; S100 calcium-binding protein A8 (calgranulin A) ; calgranulin A; cystic fibrosis ant; S100 calcium binding protein A8
⇄products_gene_name => string (6) "S100A8"
$value[19]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[19]['_source']['products_gene_name_syn']
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[19]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for S100A8 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any S100A8 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for S100A8 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of S100A8 bound in the initial step. The color development is stopped and the intensity of the color is measured.
protein S100-A8; MRP-8; calgranulin A; calgranulin-A; cystic fibrosis antigen; calprotectin L1L subunit; urinary stone protein band A; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; S100 calcium-binding protein A8 (calgranulin A)
Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen; CFAG; Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8; MRP-8; p8; S100 calcium-binding protein A8; Urinary stone protein band ACleaved into the following chain:Protein S100-A8, N-terminally processed
⇄⧉search_terms => string (831) "aaa15675 human this assay has high sensitivity and excellent specificity for...
$value[19]['_source']['search_terms']
aaa15675 human this assay has high sensitivity and excellent specificity for detection of s100a8 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15675_td elisa kit s100 calcium binding protein a8 calgranulin a 60b8ag caga cfag cgla cp 10 l1ag ma387 mif mrp8 nif p8 otthump00000015330 cystic fibrosis ant mrp 8 antigen calprotectin l1l subunit urinary stone band leukocyte l1 complex light chain migration inhibitory factor related 10,835 da acleaved into the following chain:protein n terminally processed s10a8_human 21614544 np_002955.2 p05109 nm_002964.4 q5sy70 q9uc84 q9uc92 q9ucj0 q9ucm6 a8k5l3 d3dv37 123885 samples serum plasma tissue homogenates type quantitative sandwich range 1.25 ng ml 80 < 0.31 intra precision within an cv cp10 ml80
