Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using P2RY8 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human P2RY8 Polyclonal Antibody | anti-P2RY8 antibody

P2RY8 Rabbit pAb

Gene Names
P2RY8; P2Y8
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
P2RY8; Polyclonal Antibody; P2RY8 Rabbit pAb; P2Y8; anti-P2RY8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
REFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
Applicable Applications for anti-P2RY8 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 298-359 of human P2RY8 (NP_835230.1).
Positive Samples
SGC-7901, Raji, K-562, 293T
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using P2RY8 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using P2RY8 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-P2RY8 antibody
Background: The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene is moderately expressed in undifferentiated HL60 cells, and is located on both chromosomes X and Y. [provided by RefSeq, Jul 2008]
Product Categories/Family for anti-P2RY8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,635 Da
NCBI Official Full Name
P2Y purinoceptor 8
NCBI Official Synonym Full Names
purinergic receptor P2Y, G-protein coupled, 8
NCBI Official Symbol
P2RY8
NCBI Official Synonym Symbols
P2Y8
NCBI Protein Information
P2Y purinoceptor 8; G-protein coupled purinergic receptor P2Y8
UniProt Protein Name
P2Y purinoceptor 8
Protein Family
UniProt Gene Name
P2RY8
UniProt Synonym Gene Names
P2Y8
UniProt Entry Name
P2RY8_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene is moderately expressed in undifferentiated HL60 cells, and is located on both chromosomes X and Y. [provided by RefSeq, Jul 2008]

Uniprot Description

P2RY8: Probable receptor for purines coupled to G-proteins. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.33; Yp11.3

Cellular Component: integral to membrane; plasma membrane

Molecular Function: purinergic nucleotide receptor activity, G-protein coupled

Research Articles on P2RY8

Similar Products

Product Notes

The P2RY8 p2ry8 (Catalog #AAA9143068) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RY8 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's P2RY8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the P2RY8 p2ry8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: REFQLRLREY LGCRRVPRDT LDTRRESLFS ARTTSVRSEA GAHPEGMEGA TRPGLQRQES VF. It is sometimes possible for the material contained within the vial of "P2RY8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.