Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit OTX2 Polyclonal Antibody | anti-OTX2 antibody

OTX2 antibody - middle region

Gene Names
OTX2; CPHD6; MCOPS5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OTX2; Polyclonal Antibody; OTX2 antibody - middle region; anti-OTX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPV
Sequence Length
297
Applicable Applications for anti-OTX2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OTX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-OTX2 antibody
This is a rabbit polyclonal antibody against OTX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Homeobox protein OTX2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. This protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
homeobox protein OTX2 isoform a
NCBI Official Synonym Full Names
orthodenticle homeobox 2
NCBI Official Symbol
OTX2
NCBI Official Synonym Symbols
CPHD6; MCOPS5
NCBI Protein Information
homeobox protein OTX2
UniProt Protein Name
Homeobox protein OTX2
Protein Family
UniProt Gene Name
OTX2
UniProt Entry Name
OTX2_HUMAN

NCBI Description

This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine. [provided by RefSeq, Jul 2012]

Uniprot Description

OTX2: Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'. Expressed in brain. Belongs to the paired homeobox family. Bicoid subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 14q22.3

Cellular Component: growth cone; nucleus; protein complex

Molecular Function: eukaryotic initiation factor 4E binding; protein binding

Biological Process: axon guidance; forebrain development; midbrain development; positive regulation of embryonic development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein complex assembly; regulation of fibroblast growth factor receptor signaling pathway; regulation of smoothened signaling pathway; transcription from RNA polymerase II promoter

Disease: Microphthalmia, Syndromic 5; Pituitary Hormone Deficiency, Combined, 6

Research Articles on OTX2

Similar Products

Product Notes

The OTX2 otx2 (Catalog #AAA3200941) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTX2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OTX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTX2 otx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQNGGQNKVR PAKKKTSPAR EVSSESGTSG QFTPPSSTSV PTIASSSAPV. It is sometimes possible for the material contained within the vial of "OTX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.