Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: OTCSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse OTC Polyclonal Antibody | anti-OTC antibody

OTC Antibody - C-terminal region

Gene Names
Otc; Sf; spf; AI265390
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
OTC; Polyclonal Antibody; OTC Antibody - C-terminal region; anti-OTC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKW
Sequence Length
354
Applicable Applications for anti-OTC antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OTC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: OTCSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: OTCSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-OTC antibody
The function of this protein remains unknown.
Product Categories/Family for anti-OTC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
ornithine carbamoyltransferase, mitochondrial
NCBI Official Synonym Full Names
ornithine transcarbamylase
NCBI Official Symbol
Otc
NCBI Official Synonym Symbols
Sf; spf; AI265390
NCBI Protein Information
ornithine carbamoyltransferase, mitochondrial
UniProt Protein Name
Ornithine carbamoyltransferase, mitochondrial
UniProt Gene Name
Otc
UniProt Synonym Gene Names
OTCase
UniProt Entry Name
OTC_MOUSE

Uniprot Description

OTC: Defects in OTC are the cause of ornithine carbamoyltransferase deficiency (OTCD). OTCD is an X- linked disorder of the urea cycle which causes a form of hyperammonemia. Mutations with no residual enzyme activity are always expressed in hemizygote males by a very severe neonatal hyperammonemic coma that generally proves to be fatal. Heterozygous females are either asymptomatic or express orotic aciduria spontaneously or after protein intake. The disorder is treatable with supplemental dietary arginine and low protein diet. The arbitrary classification of patients into the 'neonatal' group (clinical hyperammonemia in the first few days of life) and 'late' onset (clinical presentation after the neonatal period) has been used to differentiate severe from mild forms. Belongs to the ATCase/OTCase family.

Protein type: Mitochondrial; Transferase; Amino Acid Metabolism - arginine and proline; EC 2.1.3.3

Cellular Component: mitochondrion; cytoplasm; mitochondrial inner membrane

Molecular Function: transferase activity; amino acid binding; carboxyl- or carbamoyltransferase activity; ornithine carbamoyltransferase activity; phospholipid binding; phosphate binding

Biological Process: amino acid metabolic process; citrulline biosynthetic process; arginine biosynthetic process; ornithine metabolic process; arginine biosynthetic process via ornithine; amino acid biosynthetic process; ornithine catabolic process; anion homeostasis; urea cycle

Research Articles on OTC

Similar Products

Product Notes

The OTC otc (Catalog #AAA3223581) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTC Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's OTC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTC otc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYQVTMKTAK VAASDWTFLH CLPRKPEEVD DEVFYSPRSL VFPEAENRKW. It is sometimes possible for the material contained within the vial of "OTC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.