Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of mouse pancreas, using Osteocalcin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 90s.)

Rabbit anti-Human, Mouse Osteocalcin Polyclonal Antibody | anti-BGLAP antibody

Osteocalcin Rabbit pAb

Gene Names
BGLAP; OC; BGP; OCN
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
Osteocalcin; Polyclonal Antibody; Osteocalcin Rabbit pAb; BGLAP; BGP; OC; OCN; osteocalcin; anti-BGLAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Affinity purified
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Applicable Applications for anti-BGLAP antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BGLAP (NP_954642.1).MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Positive Control
U-251MG, Mouse pancreas
Conjugation
Unconjugated
Modification
Unmodified
Cell Position
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of mouse pancreas, using Osteocalcin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of mouse pancreas, using Osteocalcin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 90s.)
Related Product Information for anti-BGLAP antibody
This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product.
Product Categories/Family for anti-BGLAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
632
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,963 Da
NCBI Official Full Name
osteocalcin preproprotein
NCBI Official Synonym Full Names
bone gamma-carboxyglutamate (gla) protein
NCBI Official Symbol
BGLAP
NCBI Official Synonym Symbols
OC; BGP; OCN
NCBI Protein Information
osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin)
UniProt Protein Name
Osteocalcin
Protein Family
UniProt Gene Name
BGLAP
UniProt Synonym Gene Names
BGP
UniProt Entry Name
OSTCN_HUMAN

NCBI Description

This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]

Uniprot Description

osteocalcin: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Belongs to the osteocalcin/matrix Gla protein family.

Protein type: Secreted, signal peptide; Secreted; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: Golgi apparatus; extracellular space; rough endoplasmic reticulum; dendrite; cytoplasm; perikaryon

Molecular Function: structural constituent of bone; hydroxyapatite binding; calcium ion binding; structural molecule activity

Biological Process: response to drug; response to gravity; regulation of bone resorption; response to glucocorticoid stimulus; cell aging; response to testosterone stimulus; bone mineralization; osteoblast development; odontogenesis; osteoblast differentiation; regulation of osteoclast differentiation; response to ethanol; response to vitamin D; response to vitamin K; response to estrogen stimulus; response to mechanical stimulus; response to zinc ion; response to hydroxyisoflavone; response to activity; cell adhesion; regulation of bone mineralization; skeletal development

Research Articles on BGLAP

Similar Products

Product Notes

The BGLAP bglap (Catalog #AAA4757688) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Osteocalcin Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Osteocalcin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the BGLAP bglap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Osteocalcin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.