Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (OSTalpha antibody (MBS839953) used at 1 ug/ml to detect target protein.)

Rabbit OSTalpha Polyclonal Antibody | anti-SLC51A antibody

OSTalpha antibody

Gene Names
SLC51A; OSTA; OSTalpha
Applications
Western Blot
Purity
Affinity purified
Synonyms
OSTalpha; Polyclonal Antibody; OSTalpha antibody; Polyclonal OSTalpha; Anti-OSTalpha; MGC39807; Organic Solute Transporter Alpha; anti-SLC51A antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
OSTalpha antibody was raised against the middle region of OSTalpha
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSTalpha antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
340
Applicable Applications for anti-SLC51A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. OSTalpha efficiently transports the major species of bile acids.
Cross-Reactivity
Human
Immunogen
OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(OSTalpha antibody (MBS839953) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (OSTalpha antibody (MBS839953) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SLC51A antibody
Rabbit polyclonal OSTalpha antibody raised against the middle region of OSTalpha
Product Categories/Family for anti-SLC51A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38 kDa (MW of target protein)
NCBI Official Full Name
organic solute transporter subunit alpha
NCBI Official Synonym Full Names
solute carrier family 51, alpha subunit
NCBI Official Symbol
SLC51A
NCBI Official Synonym Symbols
OSTA; OSTalpha
NCBI Protein Information
organic solute transporter subunit alpha
UniProt Protein Name
Organic solute transporter subunit alpha
UniProt Gene Name
SLC51A
UniProt Synonym Gene Names
OSTA; OST-alpha
UniProt Entry Name
OSTA_HUMAN

Uniprot Description

OSTalpha: Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Belongs to the OST-alpha family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: endoplasmic reticulum membrane; protein complex; plasma membrane; integral to membrane

Molecular Function: protein homodimerization activity; transporter activity; protein heterodimerization activity

Biological Process: bile acid and bile salt transport; transport

Research Articles on SLC51A

Similar Products

Product Notes

The SLC51A slc51a (Catalog #AAA839953) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's OSTalpha can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC51A slc51a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSTalpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.