Western Blot (WB)
(Host: RabbitTarget Name: OSGIN1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Rabbit OSGIN1 Polyclonal Antibody | anti-OSGIN1 antibody
OSGIN1 antibody - N-terminal region
Gene Names
OSGIN1; BDGI; OKL38
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OSGIN1; Polyclonal Antibody; OSGIN1 antibody - N-terminal region; anti-OSGIN1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW
Sequence Length
560
Applicable Applications for anti-OSGIN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OSGIN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: OSGIN1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: OSGIN1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-OSGIN1 antibody
This is a rabbit polyclonal antibody against OSGIN1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.
Target Description: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.
Product Categories/Family for anti-OSGIN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Synonym Full Names
oxidative stress induced growth inhibitor 1
NCBI Official Symbol
OSGIN1
NCBI Official Synonym Symbols
BDGI; OKL38
NCBI Protein Information
oxidative stress-induced growth inhibitor 1
UniProt Protein Name
Oxidative stress-induced growth inhibitor 1
Protein Family
UniProt Gene Name
OSGIN1
UniProt Synonym Gene Names
OKL38; huOKL38
NCBI Description
This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules. The loss of this protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists between this gene and the neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, but the read-through transcripts are unlikely to produce a protein product. [provided by RefSeq, Aug 2011]
Uniprot Description
Regulates the differentiation and proliferation of normal cells through the regulation of cell death.
Research Articles on OSGIN1
Similar Products
Product Notes
The OSGIN1 osgin1 (Catalog #AAA3212439) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OSGIN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OSGIN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OSGIN1 osgin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APGVSILDQD LDYLSEGLEG RSQSPVALLF DALLRPDTDF GGNMKSVLTW. It is sometimes possible for the material contained within the vial of "OSGIN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
