Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OSGEP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateOSGEP is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit OSGEP Polyclonal Antibody | anti-OSGEP antibody

OSGEP antibody - middle region

Gene Names
OSGEP; KAE1; TCS3; GCPL1; GAMOS3; OSGEP1; PRSMG1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OSGEP; Polyclonal Antibody; OSGEP antibody - middle region; anti-OSGEP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE
Sequence Length
335
Applicable Applications for anti-OSGEP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OSGEP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OSGEP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateOSGEP is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-OSGEP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateOSGEP is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-OSGEP antibody
This is a rabbit polyclonal antibody against OSGEP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.
Product Categories/Family for anti-OSGEP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
probable tRNA N6-adenosine threonylcarbamoyltransferase
NCBI Official Synonym Full Names
O-sialoglycoprotein endopeptidase
NCBI Official Symbol
OSGEP
NCBI Official Synonym Symbols
KAE1; TCS3; GCPL1; GAMOS3; OSGEP1; PRSMG1
NCBI Protein Information
probable tRNA N6-adenosine threonylcarbamoyltransferase
UniProt Protein Name
Probable tRNA N6-adenosine threonylcarbamoyltransferase
UniProt Gene Name
OSGEP
UniProt Synonym Gene Names
t(6)A synthase; hOSGEP
UniProt Entry Name
OSGEP_HUMAN

Uniprot Description

OSGEP: Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Belongs to the KAE1 / YgjD family.

Protein type: EC 2.6.99.4; Protease

Chromosomal Location of Human Ortholog: 14q11.2

Research Articles on OSGEP

Similar Products

Product Notes

The OSGEP osgep (Catalog #AAA3213142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OSGEP antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OSGEP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OSGEP osgep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHRYRIFGET IDIAVGNCLD RFARVLKISN DPSPGYNIEQ MAKRGKKLVE. It is sometimes possible for the material contained within the vial of "OSGEP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.