Western Blot (WB)
(Host: RabbitTarget Name: OSBPL11Sample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human OSBPL11 Polyclonal Antibody | anti-OSBPL11 antibody
OSBPL11 Antibody - N-terminal region
Gene Names
OSBPL11; ORP11; ORP-11; OSBP12; TCCCIA00292
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
OSBPL11; Polyclonal Antibody; OSBPL11 Antibody - N-terminal region; anti-OSBPL11 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNSSCGGGISSSSSSRGGSAKGWQYSDHMENVYGYLMKYTNLVTGWQYRF
Sequence Length
747
Applicable Applications for anti-OSBPL11 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: OSBPL11Sample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: OSBPL11Sample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-OSBPL11 antibody
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.
Product Categories/Family for anti-OSBPL11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82 kDa
NCBI Official Full Name
oxysterol-binding protein-related protein 11
NCBI Official Synonym Full Names
oxysterol binding protein like 11
NCBI Official Symbol
OSBPL11
NCBI Official Synonym Symbols
ORP11; ORP-11; OSBP12; TCCCIA00292
NCBI Protein Information
oxysterol-binding protein-related protein 11
UniProt Protein Name
Oxysterol-binding protein-related protein 11
Protein Family
UniProt Gene Name
OSBPL11
UniProt Synonym Gene Names
ORP11; OSBP12; ORP-11; OSBP-related protein 11
NCBI Description
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. [provided by RefSeq, Jul 2008]
Uniprot Description
Plays a role in regulating ADIPOQ and FABP4 levels in differentiating adipocytes and is also involved in regulation of adipocyte triglyceride storage (PubMed:23028956). Weakly binds 25-hydroxycholesterol (PubMed:17428193).
Research Articles on OSBPL11
Similar Products
Product Notes
The OSBPL11 osbpl11 (Catalog #AAA3222247) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OSBPL11 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OSBPL11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OSBPL11 osbpl11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNSSCGGGIS SSSSSRGGSA KGWQYSDHME NVYGYLMKYT NLVTGWQYRF. It is sometimes possible for the material contained within the vial of "OSBPL11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
