Rabbit anti-Human ORC4L Polyclonal Antibody | anti-ORC4L antibody

ORC4L (Origin Recognition Complex Subunit 4, ORC4) (PE)

Cat. Num. AAA6388073

• Gene Names: ORC4; ORC4L; ORC4P
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ORC4L; Polyclonal Antibody; ORC4L (Origin Recognition Complex Subunit 4; ORC4) (PE); anti-ORC4L antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ORC4L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ORC4L antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ORC4L, aa1-436 (NP_002543.2).
• Immunogen Sequence: MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ORC4L expression in transfected 293T cell line by ORC4L polyclonal antibody. Lane 1: ORC4L transfected lysate (50.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ORC4L antibody

ORC4L is required for initiation of DNA replication with a putative nucleotide triphosphate binding motif.

Product Categories/Family for anti-ORC4L antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 32454750
• NCBI GeneID: 5000
• NCBI Accession #: NP_002543.2
• NCBI GenBank Nucleotide #: NM_002552
• Molecular Weight: 42,034 Da
• NCBI Official Full Name: origin recognition complex subunit 4 isoform 1
• NCBI Official Synonym Full Names: origin recognition complex subunit 4
• NCBI Official Symbol: ORC4
• NCBI Official Synonym Symbols: ORC4L; ORC4P
• NCBI Protein Information: origin recognition complex subunit 4

NCBI Description

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. [provided by RefSeq, Oct 2010]