Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ORC3L AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellORC3 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit ORC3L Polyclonal Antibody | anti-ORC3 antibody

ORC3L antibody - N-terminal region

Gene Names
ORC3; LAT; ORC3L; LATHEO
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ORC3L; Polyclonal Antibody; ORC3L antibody - N-terminal region; anti-ORC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLG
Sequence Length
712
Applicable Applications for anti-ORC3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 79%; Pig: 90%; Rabbit: 93%; Rat: 83%; Yeast: 90%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ORC3L AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellORC3 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-ORC3L AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellORC3 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-ORC3 antibody
This is a rabbit polyclonal antibody against ORC3L. It was validated on Western Blot

Target Description: The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Studies of a similar gene in Drosophila suggested a possible role of this protein in neuronal proliferation and olfactory memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene.
Product Categories/Family for anti-ORC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
origin recognition complex subunit 3 isoform 1
NCBI Official Synonym Full Names
origin recognition complex subunit 3
NCBI Official Symbol
ORC3
NCBI Official Synonym Symbols
LAT; ORC3L; LATHEO
NCBI Protein Information
origin recognition complex subunit 3
UniProt Protein Name
Origin recognition complex subunit 3
UniProt Gene Name
ORC3
UniProt Synonym Gene Names
LATHEO; ORC3L
UniProt Entry Name
ORC3_HUMAN

NCBI Description

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Studies of a similar gene in Drosophila suggested a possible role of this protein in neuronal proliferation and olfactory memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ORC3L: Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Belongs to the ORC3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 6q14.3-q16.1

Cellular Component: nucleoplasm; nuclear origin of replication recognition complex; origin recognition complex

Molecular Function: protein binding; DNA replication origin binding

Biological Process: mitotic cell cycle; DNA replication; G1/S transition of mitotic cell cycle

Research Articles on ORC3

Similar Products

Product Notes

The ORC3 orc3 (Catalog #AAA3215539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ORC3L antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ORC3L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ORC3 orc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFETYQLIWQ QMKSENERLQ EELNKNLFDN LIEFLQKSHS GFQKNSRDLG. It is sometimes possible for the material contained within the vial of "ORC3L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.