Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of HepG2 cells, using OR10H3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)

Rabbit OR10H3 Polyclonal Antibody | anti-OR10H3 antibody

OR10H3 Rabbit pAb

Gene Names
CHUK; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
OR10H3; Polyclonal Antibody; OR10H3 Rabbit pAb; anti-OR10H3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MLGLNHTSMSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCVLSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQ
Applicable Applications for anti-OR10H3 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR10H3 (NP_039227.1).
Positive Samples
HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of HepG2 cells, using OR10H3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)

Western Blot (WB) (Western blot analysis of extracts of HepG2 cells, using OR10H3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5min.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human oophoroma using OR10H3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human oophoroma using OR10H3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse brain using OR10H3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse brain using OR10H3 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-OR10H3 antibody
Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Product Categories/Family for anti-OR10H3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,640 Da
NCBI Official Full Name
inhibitor of nuclear factor kappa-B kinase subunit alpha
NCBI Official Synonym Full Names
conserved helix-loop-helix ubiquitous kinase
NCBI Official Symbol
CHUK
NCBI Official Synonym Symbols
IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit alpha; TCF-16; IKK-a kinase; I-kappa-B kinase 1; I-kappa-B kinase-alpha; transcription factor 16; IkB kinase alpha subunit; Nuclear factor NFkappaB inhibitor kinase alpha
UniProt Protein Name
Inhibitor of nuclear factor kappa-B kinase subunit alpha
Protein Family
UniProt Gene Name
CHUK
UniProt Synonym Gene Names
IKKA; TCF16; I-kappa-B kinase alpha; IKK-A; IKK-alpha; IkBKA; IkappaB kinase; IKK1; NFKBIKA; TCF-16
UniProt Entry Name
IKKA_HUMAN

NCBI Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq, Jul 2008]

Uniprot Description

IKKA: a kinase of the IKK family. Phosphorylates inhibitors of NF-kappa-B, leading to their dissociation from NF-kappa-B and ultimately to their degradation. Phosphorylated and activated downstream of growth factor receptors, IL1R, and TNFR by NAK, IRAK and NIK, respectively. Preferentially found as a heterodimer with IKK-beta but also as an homodimer. Directly interacts with IKK-gamma/NEMO and TRPC4AP. Heterodimers form the active complex. The tripartite complex can also bind to MAP3K14/NIK, MEKK1, IKAP and IKB-alpha-p65-p50 complex. Inhibitors are under development to treat arthritis, inflammation, and apoptotic aspects of cancer. Aspirin (sodium salicylate) selectively binds IKK and reduces inflammation. Misexpression and inhibitors show involvement in insulin sensitization in obese rodents. Mutations in IKK-gamma are found in several immune deficiencies: hyper IgM syndrome, incontinentia pigmenti [embryonic lethal in males, defects in skin, hair, teeth in females] and hypohidrotic ectodermal dysplasia; recurrent infections and defects in teeth, hair, and sweat glands]. Inhibitors: CHS 828, NBD peptide, BMS-345541.

Protein type: Protein kinase, Other; EC 2.7.11.10; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Other group; IKK family

Chromosomal Location of Human Ortholog: 10q24-q25

Cellular Component: nucleoplasm; internal side of plasma membrane; intracellular membrane-bound organelle; cytoplasm; IkappaB kinase complex; cytosol

Molecular Function: protein binding; protein homodimerization activity; IkappaB kinase activity; protein heterodimerization activity; ATP binding; protein kinase activity

Biological Process: skeletal muscle contraction; lactation; I-kappaB kinase/NF-kappaB cascade; nerve growth factor receptor signaling pathway; response to toxin; response to lipopolysaccharide; toll-like receptor 3 signaling pathway; osteoclast differentiation; T cell receptor signaling pathway; protein amino acid phosphorylation; Rho protein signal transduction; toll-like receptor 10 signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 5 signaling pathway; positive regulation of interferon type I production; morphogenesis of an epithelial sheet; inflammatory response; toll-like receptor 4 signaling pathway; epidermal growth factor receptor signaling pathway; response to drug; anatomical structure morphogenesis; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; response to virus; MyD88-independent toll-like receptor signaling pathway; mammary gland epithelial cell proliferation; response to amino acid stimulus; odontogenesis of dentine-containing teeth; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; response to hydroperoxide; toll-like receptor signaling pathway; innate immune response; striated muscle cell differentiation; immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; I-kappaB phosphorylation

Disease: Cocoon Syndrome

Research Articles on OR10H3

Similar Products

Product Notes

The OR10H3 chuk (Catalog #AAA9142626) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OR10H3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OR10H3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the OR10H3 chuk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLGLNHTSMS EFILVGFSAF PHLQLMLFLL FLLMYLFTLL GNLLIMATVW SERSLHTPMY LFLCVLSVSE ILYTVAIIPR MLADLLSTQR SIAFLACASQ. It is sometimes possible for the material contained within the vial of "OR10H3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.