Western Blot (WB)
(WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateONECUT2 is supported by BioGPS gene expression data to be expressed in NCIH226)
Rabbit ONECUT2 Polyclonal Antibody | anti-ONECUT2 antibody
ONECUT2 antibody - middle region
Gene Names
ONECUT2; OC2; OC-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ONECUT2; Polyclonal Antibody; ONECUT2 antibody - middle region; anti-ONECUT2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI
Sequence Length
504
Applicable Applications for anti-ONECUT2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateONECUT2 is supported by BioGPS gene expression data to be expressed in NCIH226)
Western Blot (WB)
(WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateONECUT2 is supported by BioGPS gene expression data to be expressed in NCIH226)
Related Product Information for anti-ONECUT2 antibody
This is a rabbit polyclonal antibody against ONECUT2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT
Target Description: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT
Product Categories/Family for anti-ONECUT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
one cut domain family member 2
NCBI Official Synonym Full Names
one cut homeobox 2
NCBI Official Symbol
ONECUT2
NCBI Official Synonym Symbols
OC2; OC-2
NCBI Protein Information
one cut domain family member 2
UniProt Protein Name
One cut domain family member 2
Protein Family
UniProt Gene Name
ONECUT2
UniProt Synonym Gene Names
HNF6B; HNF-6-beta; OC-2
UniProt Entry Name
ONEC2_HUMAN
NCBI Description
This gene encodes a member of the onecut family of transcription factors, which are characterized by a cut domain and an atypical homeodomain. The protein binds to specific DNA sequences and stimulates expression of target genes, including genes involved in melanocyte and hepatocyte differentiation. [provided by RefSeq, Jul 2008]
Research Articles on ONECUT2
Similar Products
Product Notes
The ONECUT2 onecut2 (Catalog #AAA3213635) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ONECUT2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ONECUT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ONECUT2 onecut2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQEPEFQRMS ALRLAACKRK EQEPNKDRNN SQKKSRLVFT DLQRRTLFAI. It is sometimes possible for the material contained within the vial of "ONECUT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
