Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OLFM4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit OLFM4 Polyclonal Antibody | anti-OLFM4 antibody

OLFM4 antibody - C-terminal region

Gene Names
OLFM4; GC1; OLM4; OlfD; GW112; hGC-1; hOLfD; UNQ362; bA209J19.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
OLFM4; Polyclonal Antibody; OLFM4 antibody - C-terminal region; anti-OLFM4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN
Sequence Length
510
Applicable Applications for anti-OLFM4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human OLFM4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OLFM4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-OLFM4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-OLFM4 antibody
This is a rabbit polyclonal antibody against OLFM4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. The protein encoded is a member of the olfactomedin-related protein family. The exact function of this gene has not yet been determined.
Product Categories/Family for anti-OLFM4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
olfactomedin-4
NCBI Official Synonym Full Names
olfactomedin 4
NCBI Official Symbol
OLFM4
NCBI Official Synonym Symbols
GC1; OLM4; OlfD; GW112; hGC-1; hOLfD; UNQ362; bA209J19.1
NCBI Protein Information
olfactomedin-4
UniProt Protein Name
Olfactomedin-4
Protein Family
UniProt Gene Name
OLFM4
UniProt Synonym Gene Names
GW112; OLM4; hGC-1
UniProt Entry Name
OLFM4_HUMAN

NCBI Description

This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth and is an extracellular matrix glycoprotein that facilitates cell adhesion. [provided by RefSeq, Mar 2011]

Uniprot Description

OLFM4: May promote proliferation of pancreatic cancer cells by favoring the transition from the S to G2/M phase. In myeloid leukemic cell lines, inhibits cell growth and induces cell differentiation and apoptosis. May play a role in the inhibition of EIF4EBP1 phosphorylation/deactivation. Facilitates cell adhesion, most probably through interaction with cell surface lectins and cadherin.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: extracellular space; azurophil granule; specific granule; mitochondrion; perinuclear region of cytoplasm; plasma membrane; secretory granule

Molecular Function: protein homodimerization activity; cadherin binding; catalytic activity

Biological Process: regulation of apoptosis; metabolic process; negative regulation of immune response; negative regulation of I-kappaB kinase/NF-kappaB cascade; cell adhesion; regulation of phagocytosis; protein homooligomerization

Research Articles on OLFM4

Similar Products

Product Notes

The OLFM4 olfm4 (Catalog #AAA3210245) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OLFM4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OLFM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OLFM4 olfm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEIFYYYDTN TGKEGKLDIV MHKMQEKVQS INYNPFDQKL YVYNDGYLLN. It is sometimes possible for the material contained within the vial of "OLFM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.