Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of OIP5 expression in transfected 293T cell line by OIP5 polyclonal antibody. Lane 1: OIP5 transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human OIP5 Polyclonal Antibody | anti-OIP5 antibody

OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B) APC

Gene Names
OIP5; CT86; MIS18B; LINT-25; MIS18beta; hMIS18beta; 5730547N13Rik
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OIP5; Polyclonal Antibody; OIP5 (Protein Mis18-beta; Cancer/Testis Antigen 86; CT86; Opa-interacting Protein 5; OIP-5; MIS18B) APC; anti-OIP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human OIP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-OIP5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human OIP5, aa1-229 (NP_009211.1).
Immunogen Sequence
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of OIP5 expression in transfected 293T cell line by OIP5 polyclonal antibody. Lane 1: OIP5 transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of OIP5 expression in transfected 293T cell line by OIP5 polyclonal antibody. Lane 1: OIP5 transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-OIP5 antibody
Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.
Product Categories/Family for anti-OIP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,691 Da
NCBI Official Full Name
protein Mis18-beta
NCBI Official Synonym Full Names
Opa interacting protein 5
NCBI Official Symbol
OIP5
NCBI Official Synonym Symbols
CT86; MIS18B; LINT-25; MIS18beta; hMIS18beta; 5730547N13Rik
NCBI Protein Information
protein Mis18-beta; OIP-5; LAP2alpha interactor-25; cancer/testis antigen 86; opa-interacting protein 5; MIS18 kinetochore protein homolog B
UniProt Protein Name
Protein Mis18-beta
Protein Family
UniProt Gene Name
OIP5
UniProt Synonym Gene Names
MIS18B; CT86; OIP-5
UniProt Entry Name
MS18B_HUMAN

Similar Products

Product Notes

The OIP5 oip5 (Catalog #AAA6387965) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OIP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OIP5 oip5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OIP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.