Immunoprecipitation (IP)
(Immunoprecipitation of NXNL1 transfected lysate using NXNL1 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NXNL1 mouse polyclonal antibody.)
Rabbit anti-Human NXNL1 Polyclonal Antibody | anti-nxnl1 antibody
NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF)
Reactivity
Human
Applications
Immunoprecipitation
Purity
SerumSerum
Synonyms
NXNL1; Polyclonal Antibody; NXNL1 (TXNL6; Nucleoredoxin-like Protein 1; Thioredoxin-like Protein 6; RDCVF); Anti -NXNL1 (TXNL6; anti-nxnl1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NXNL1.
Purity/Purification
Serum
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
Applicable Applications for anti-nxnl1 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human NXNL1, aa1-212 (NP_612463.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunoprecipitation (IP)
(Immunoprecipitation of NXNL1 transfected lysate using NXNL1 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NXNL1 mouse polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of NXNL1 transfected lysate using NXNL1 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NXNL1 mouse polyclonal antibody.)
Related Product Information for anti-nxnl1 antibody
NXNL1 may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods (By similarity).
Product Categories/Family for anti-nxnl1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,133 Da
NCBI Official Full Name
nucleoredoxin-like protein 1
NCBI Official Symbol
nxnl1
NCBI Protein Information
nucleoredoxin-like protein 1
UniProt Protein Name
Nucleoredoxin-like protein 1
Protein Family
UniProt Gene Name
nxnl1
UniProt Entry Name
NXNL1_DANRE
Uniprot Description
Function: May play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods
By similarity.
Subcellular location: Nucleus outer membrane
By similarity.
Sequence similarities: Belongs to the nucleoredoxin family.Contains 1 thioredoxin domain.
Similar Products
Product Notes
The nxnl1 nxnl1 (Catalog #AAA6003918) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NXNL1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the nxnl1 nxnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASLFSGRIL IRNNSDQDEL DTEAEVSRRL ENRLVLLFFG AGACPQCQAF VPILKDFFVR LTDEFYVLRA AQLALVYVSQ DSTEEQQDLF LKDMPKKWLF LPFEDDLRRD LGRQFSVERL PAVVVLKPDG DVLTRDGADE IQRLGTACFA NWQEAAEVLD RNFQLPEDLE DQEPRSLTEC LRRHKYRVEK AARGGRDPGG GGGEEGGAGG LF. It is sometimes possible for the material contained within the vial of "NXNL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
