Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NUSAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit NUSAP1 Polyclonal Antibody | anti-NUSAP1 antibody

NUSAP1 antibody - middle region

Gene Names
NUSAP1; LNP; ANKT; SAPL; BM037; NUSAP; Q0310; PRO0310p1
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUSAP1; Polyclonal Antibody; NUSAP1 antibody - middle region; anti-NUSAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
Sequence Length
440
Applicable Applications for anti-NUSAP1 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NUSAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NUSAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NUSAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-NUSAP1 antibody
This is a rabbit polyclonal antibody against NUSAP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
Product Categories/Family for anti-NUSAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
nucleolar and spindle-associated protein 1 isoform 4
NCBI Official Synonym Full Names
nucleolar and spindle associated protein 1
NCBI Official Symbol
NUSAP1
NCBI Official Synonym Symbols
LNP; ANKT; SAPL; BM037; NUSAP; Q0310; PRO0310p1
NCBI Protein Information
nucleolar and spindle-associated protein 1
UniProt Protein Name
Nucleolar and spindle-associated protein 1
UniProt Gene Name
NUSAP1
UniProt Synonym Gene Names
ANKT; NuSAP
UniProt Entry Name
NUSAP_HUMAN

NCBI Description

NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]).[supplied by OMIM, Jun 2009]

Uniprot Description

NUSAP1: Microtubule-associated protein with the capacity to bundle and stabilize microtubules. May associate with chromosomes and promote the organization of mitotic spindle microtubules around them. Belongs to the NUSAP family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Cell cycle regulation

Chromosomal Location of Human Ortholog: 15q15.1

Cellular Component: spindle microtubule; cytoplasm; nucleolus; chromosome; nucleus

Molecular Function: DNA binding; microtubule binding

Biological Process: establishment of mitotic spindle localization; cytokinesis after mitosis; mitotic sister chromatid segregation; positive regulation of mitosis; mitotic chromosome condensation

Research Articles on NUSAP1

Similar Products

Product Notes

The NUSAP1 nusap1 (Catalog #AAA3208143) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUSAP1 antibody - middle region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NUSAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUSAP1 nusap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AENAVSSGNR DSKVPSEGKK SLYTDESSKP GKNKRTAITT PNFKKLHEAH. It is sometimes possible for the material contained within the vial of "NUSAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.