Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NUDT5 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit NUDT5 Polyclonal Antibody | anti-NUDT5 antibody

NUDT5 Antibody - N-terminal region

Gene Names
NUDT5; YSA1; YSA1H; YSAH1; hNUDT5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUDT5; Polyclonal Antibody; NUDT5 Antibody - N-terminal region; anti-NUDT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVK
Sequence Length
219
Applicable Applications for anti-NUDT5 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NUDT5 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-NUDT5 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-NUDT5 antibody
This is a rabbit polyclonal antibody against NUDT5. It was validated on Western Blot

Target Description: Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites.
Product Categories/Family for anti-NUDT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ADP-sugar pyrophosphatase isoform 1
NCBI Official Synonym Full Names
nudix hydrolase 5
NCBI Official Symbol
NUDT5
NCBI Official Synonym Symbols
YSA1; YSA1H; YSAH1; hNUDT5
NCBI Protein Information
ADP-sugar pyrophosphatase
UniProt Protein Name
ADP-sugar pyrophosphatase
Protein Family
UniProt Gene Name
NUDT5
UniProt Synonym Gene Names
Nudix motif 5
UniProt Entry Name
NUDT5_HUMAN

NCBI Description

This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors. [provided by RefSeq, Aug 2013]

Uniprot Description

NUDT5: Hydrolyzes with similar activities ADP-ribose ADP- mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP. Can also hydrolyze other nucleotide sugars with low activity. Belongs to the Nudix hydrolase family.

Protein type: EC 3.6.1.13; Nucleotide Metabolism - purine; Phosphatase; EC 3.6.1.58

Chromosomal Location of Human Ortholog: 10p14

Cellular Component: intracellular; cytosol; nucleus

Molecular Function: snoRNA binding; m7G(5')pppN diphosphatase activity; ADP-ribose diphosphatase activity; nucleoside-diphosphatase activity; magnesium ion binding; ADP-sugar diphosphatase activity

Biological Process: nucleobase, nucleoside and nucleotide metabolic process; nucleotide metabolic process; D-ribose catabolic process; ribonucleoside diphosphate catabolic process

Research Articles on NUDT5

Similar Products

Product Notes

The NUDT5 nudt5 (Catalog #AAA3216794) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT5 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUDT5 nudt5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKTTYMDPTG KTRTWESVKR TTRKEQTADG VAVIPVLQRT LHYECIVLVK. It is sometimes possible for the material contained within the vial of "NUDT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.