Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NUDT3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/mlNUDT3 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit NUDT3 Polyclonal Antibody | anti-NUDT3 antibody

NUDT3 Antibody - middle region

Gene Names
NUDT3; DIPP; DIPP1; DIPP-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUDT3; Polyclonal Antibody; NUDT3 Antibody - middle region; anti-NUDT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKI
Sequence Length
172
Applicable Applications for anti-NUDT3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NUDT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NUDT3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/mlNUDT3 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (Host: RabbitTarget Name: NUDT3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/mlNUDT3 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-NUDT3 antibody
This is a rabbit polyclonal antibody against NUDT3. It was validated on Western Blot

Target Description: NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions.
Product Categories/Family for anti-NUDT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
diphosphoinositol polyphosphate phosphohydrolase 1
NCBI Official Synonym Full Names
nudix hydrolase 3
NCBI Official Symbol
NUDT3
NCBI Official Synonym Symbols
DIPP; DIPP1; DIPP-1
NCBI Protein Information
diphosphoinositol polyphosphate phosphohydrolase 1
UniProt Protein Name
Diphosphoinositol polyphosphate phosphohydrolase 1
UniProt Gene Name
NUDT3
UniProt Synonym Gene Names
DIPP; DIPP1; DIPP-1; Nudix motif 3
UniProt Entry Name
NUDT3_HUMAN

NCBI Description

NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM, Feb 2011]

Uniprot Description

NUDT3: Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphophate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5- phosphoribose 1-diphosphate. Belongs to the Nudix hydrolase family. DIPP subfamily.

Protein type: Hydrolase; EC 3.6.1.52

Chromosomal Location of Human Ortholog: 6p21.2

Cellular Component: cytosol

Molecular Function: magnesium ion binding; diphosphoinositol-polyphosphate diphosphatase activity

Biological Process: inositol phosphate metabolic process; cell-cell signaling; diadenosine polyphosphate catabolic process

Research Articles on NUDT3

Similar Products

Product Notes

The NUDT3 nudt3 (Catalog #AAA3217862) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT3 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUDT3 nudt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKGTLGRLVG IFENQERKHR TYVYVLIVTE VLEDWEDSVN IGRKREWFKI. It is sometimes possible for the material contained within the vial of "NUDT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.