Rabbit anti-Human NUDT2 Polyclonal Antibody | anti-NUDT2 antibody

NUDT2 (Nudix-type Motif 2, APAH1, Bis(5'-nucleosyl)-tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1,P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2)

Cat. Num. AAA6002797

• Gene Names: NUDT2; ARABIDOPSIS THALIANA NUDIX HYDROLASE HOMOLOG 2; ATNUDT2; ATNUDX2; MNJ7.24; MNJ7_24; nudix hydrolase homolog 2; NUDT2
• Reactivity: Human
• Applications: Western Blot, Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: NUDT2; Polyclonal Antibody; NUDT2 (Nudix-type Motif 2; APAH1; Bis(5'-nucleosyl)-tetraphosphatase [Asymmetrical]; Diadenosine 5'; 5'''-P1; P4-tetraphosphate Asymmetrical Hydrolase; Diadenosine Tetraphosphatase; Ap4A Hydrolase; Ap4Aase; Nucleoside Diphosphate-linked Moiety X Motif 2); Anti -NUDT2 (Nudix-type Motif 2; anti-NUDT2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NUDT2.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

• Applicable Applications for anti-NUDT2 antibody: Western Blot (WB), Immunoprecipitation (IP)
• Application Notes: Suitable for use in Western Blot and Immunoprecipitation.
• Immunogen: Full length human NUDT2, aa1-147 (NP_001152.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of NUDT2 transfected lysate using NUDT2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NUDT2 mouse polyclonal antibody.)

Related Product Information for anti-NUDT2 antibody

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified.

Product Categories/Family for anti-NUDT2 antibody

Antibodies; Abs to RNA Processing

NCBI and Uniprot Product Information

• NCBI GI #: 18422823
• NCBI GeneID: 834816
• NCBI Accession #: NP_568687.1
• NCBI GenBank Nucleotide #: NM_124139.3
• UniProt Accession #: Q94B74; Q9FGJ2
• Molecular Weight: 31,611 Da
• NCBI Official Full Name: nudix hydrolase 2
• NCBI Official Symbol: NUDT2
• NCBI Official Synonym Symbols: ARABIDOPSIS THALIANA NUDIX HYDROLASE HOMOLOG 2; ATNUDT2; ATNUDX2; MNJ7.24; MNJ7_24; nudix hydrolase homolog 2; NUDT2
• NCBI Protein Information: nudix hydrolase 2
• UniProt Protein Name: Nudix hydrolase 2
• Protein Family: Nudix hydrolase
• UniProt Gene Name: NUDT2
• UniProt Synonym Gene Names: NUDX2; AtNUDT2
• UniProt Entry Name: NUDT2_ARATH

Uniprot Description

Function: Probably mediates the hydrolysis of some nucleoside diphosphate derivatives. In vitro, it can use both NADH and ADP-ribose as substrates; however the relevance of such substrates in vivo is unclear. Ref.4 Ref.5

Catalytic activity: ADP-D-ribose + H2O = AMP + D-ribose 5-phosphate.NAD+ + H2O = AMP + NMN.

Cofactor: Magnesium or manganese

By similarity.

Tissue specificity: Expressed in roots, stems and leaves. Ref.4

Induction: By paraquat, drought and high salinity. Ref.5

Miscellaneous: Overexpression of NUTD2 confers enhanced tolerance to oxidative stress.

Sequence similarities: Belongs to the Nudix hydrolase family.Contains 1 nudix hydrolase domain.

Biophysicochemical propertiesKinetic parameters:KM=16.9 µM for ADP-ribose Ref.4KM=23.1 µM for NADHVmax=0.20 µmol/min/mg enzyme with ADP-ribose as substrateVmax=0.16 µmol/min/mg enzyme with NADH as substrate

Sequence caution: The sequence BAB09091.1 differs from that shown. Reason: Erroneous initiation.