Western Blot (WB)
(WB Suggested Anti-Nudt15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Rabbit Nudt15 Polyclonal Antibody | anti-NUDT15 antibody
Nudt15 antibody - N-terminal region
Gene Names
Nudt15; MTH2; 6530403O17; A730068G11Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nudt15; Polyclonal Antibody; Nudt15 antibody - N-terminal region; anti-NUDT15 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS
Sequence Length
170
Applicable Applications for anti-NUDT15 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Nudt15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Western Blot (WB)
(WB Suggested Anti-Nudt15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Related Product Information for anti-NUDT15 antibody
This is a rabbit polyclonal antibody against Nudt15. It was validated on Western Blot
Target Description: Nudt15 mediates the hydrolysis of some nucleoside diphosphate derivatives. It can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions. Its substrate specificity in vivo however remains unclear. Nudt15 may have a role in DNA synthesis and cell cycle progression throught the interaction with PCNA.
Target Description: Nudt15 mediates the hydrolysis of some nucleoside diphosphate derivatives. It can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions. Its substrate specificity in vivo however remains unclear. Nudt15 may have a role in DNA synthesis and cell cycle progression throught the interaction with PCNA.
Product Categories/Family for anti-NUDT15 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
nucleotide triphosphate diphosphatase NUDT15
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 15
NCBI Official Symbol
Nudt15
NCBI Official Synonym Symbols
MTH2; 6530403O17; A730068G11Rik
NCBI Protein Information
nucleotide triphosphate diphosphatase NUDT15; probable 8-oxo-dGTP diphosphatase NUDT15
UniProt Protein Name
Probable 8-oxo-dGTP diphosphatase NUDT15
Protein Family
UniProt Gene Name
Nudt15
UniProt Synonym Gene Names
Mth2; 8-oxo-dGTPase NUDT15; mMTH2; Nudix motif 15
UniProt Entry Name
NUD15_MOUSE
Research Articles on NUDT15
Similar Products
Product Notes
The NUDT15 nudt15 (Catalog #AAA3209192) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nudt15 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Nudt15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUDT15 nudt15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RKGSFGAGSF QLPGGHLEFG ETWEECAQRE TWEEAGLHLK NVCFASVVNS. It is sometimes possible for the material contained within the vial of "Nudt15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
