Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NT5M Antibody Titration: 0.2-1 ug/mlPositive Control: A549 cell lysateNT5M is supported by BioGPS gene expression data to be expressed in A549)

Rabbit NT5M Polyclonal Antibody | anti-NT5M antibody

NT5M antibody - N-terminal region

Gene Names
NT5M; mdN; dNT2; dNT-2
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NT5M; Polyclonal Antibody; NT5M antibody - N-terminal region; anti-NT5M antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL
Sequence Length
228
Applicable Applications for anti-NT5M antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NT5M
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NT5M Antibody Titration: 0.2-1 ug/mlPositive Control: A549 cell lysateNT5M is supported by BioGPS gene expression data to be expressed in A549)

Western Blot (WB) (WB Suggested Anti-NT5M Antibody Titration: 0.2-1 ug/mlPositive Control: A549 cell lysateNT5M is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-NT5M antibody
This is a rabbit polyclonal antibody against NT5M. It was validated on Western Blot

Target Description: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
5'(3')-deoxyribonucleotidase, mitochondrial
NCBI Official Synonym Full Names
5',3'-nucleotidase, mitochondrial
NCBI Official Symbol
NT5M
NCBI Official Synonym Symbols
mdN; dNT2; dNT-2
NCBI Protein Information
5'(3')-deoxyribonucleotidase, mitochondrial
UniProt Protein Name
5'(3')-deoxyribonucleotidase, mitochondrial
UniProt Gene Name
NT5M
UniProt Synonym Gene Names
DNT2; 5',3'-nucleotidase, mitochondrial; dNT-2
UniProt Entry Name
NT5M_HUMAN

NCBI Description

This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

NT5M: Dephosphorylates specifically the 5' and 2'(3')- phosphates of uracil and thymine deoxyribonucleotides, and so protects mitochondrial DNA replication from excess dTTP. Has only marginal activity towards dIMP and dGMP. Belongs to the 5'(3')-deoxyribonucleotidase family.

Protein type: Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Nucleotide Metabolism - pyrimidine; Mitochondrial; EC 3.1.3.-; Nucleotide Metabolism - purine; Phosphatase (non-protein); DNA replication

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: 5'-nucleotidase activity; metal ion binding; nucleotide binding; nucleotidase activity

Biological Process: pyrimidine nucleoside catabolic process; pyrimidine base metabolic process; dephosphorylation; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine deoxyribonucleotide catabolic process; dUMP catabolic process; DNA replication

Research Articles on NT5M

Similar Products

Product Notes

The NT5M nt5m (Catalog #AAA3213326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NT5M antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NT5M can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NT5M nt5m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALRVLVDMDG VLADFEGGFL RKFRARFPDQ PFIALEDRRG FWVSEQYGRL. It is sometimes possible for the material contained within the vial of "NT5M, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.