Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RatTarget Name: NT5ESample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Rabbit NT5E Polyclonal Antibody | anti-NT5E antibody

NT5E antibody - C-terminal region

Gene Names
NT5E; NT; eN; NT5; NTE; eNT; CD73; E5NT; CALJA
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NT5E; Polyclonal Antibody; NT5E antibody - C-terminal region; anti-NT5E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVP
Sequence Length
574
Applicable Applications for anti-NT5E antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RatTarget Name: NT5ESample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: NT5ESample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-NT5E AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-NT5E AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-NT5E antibody
This is a rabbit polyclonal antibody against NT5E. It was validated on Western Blot

Target Description: The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NT5E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
5'-nucleotidase isoform 1 preproprotein
NCBI Official Synonym Full Names
5'-nucleotidase ecto
NCBI Official Symbol
NT5E
NCBI Official Synonym Symbols
NT; eN; NT5; NTE; eNT; CD73; E5NT; CALJA
NCBI Protein Information
5'-nucleotidase
UniProt Protein Name
5'-nucleotidase
UniProt Gene Name
NT5E
UniProt Synonym Gene Names
NT5; NTE; 5'-NT
UniProt Entry Name
5NTD_HUMAN

NCBI Description

The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]

Uniprot Description

NT5E: Hydrolyzes extracellular nucleotides into membrane permeable nucleosides. Homodimer; disulfide-linked. Belongs to the 5'-nucleotidase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.5; Membrane protein, integral; Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; Phosphatase (non-protein); Membrane protein, GPI anchor; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide

Chromosomal Location of Human Ortholog: 6q14-q21

Cellular Component: cell surface; membrane; cytoplasm; plasma membrane

Molecular Function: 5'-nucleotidase activity; metal ion binding; nucleotide binding

Biological Process: pyrimidine nucleoside catabolic process; dephosphorylation; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; adenosine biosynthetic process; negative regulation of inflammatory response; purine nucleotide catabolic process; DNA metabolic process; purine base metabolic process; AMP catabolic process

Disease: Calcification Of Joints And Arteries

Research Articles on NT5E

Similar Products

Product Notes

The NT5E nt5e (Catalog #AAA3216614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NT5E antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NT5E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NT5E nt5e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAFEHSVHRY GQSTGEFLQV GGIHVVYDLS RKPGDRVVKL DVLCTKCRVP. It is sometimes possible for the material contained within the vial of "NT5E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.