Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NSUN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Rabbit NSUN2 Polyclonal Antibody | anti-NSUN2 antibody

NSUN2 antibody - C-terminal region

Gene Names
NSUN2; MISU; MRT5; SAKI; TRM4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NSUN2; Polyclonal Antibody; NSUN2 antibody - C-terminal region; anti-NSUN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP
Sequence Length
767
Applicable Applications for anti-NSUN2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NSUN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NSUN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-NSUN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-NSUN2 antibody
This is a rabbit polyclonal antibody against NSUN2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 is a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA).Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA) (Brzezicha et al., 2006 [PubMed 17071714]).[supplied by OMIM].
Product Categories/Family for anti-NSUN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
tRNA (cytosine(34)-C(5))-methyltransferase isoform 1
NCBI Official Synonym Full Names
NOP2/Sun RNA methyltransferase family member 2
NCBI Official Symbol
NSUN2
NCBI Official Synonym Symbols
MISU; MRT5; SAKI; TRM4
NCBI Protein Information
tRNA (cytosine(34)-C(5))-methyltransferase
UniProt Protein Name
tRNA (cytosine(34)-C(5))-methyltransferase
Protein Family
UniProt Gene Name
NSUN2
UniProt Synonym Gene Names
SAKI; TRM4; Misu; hTrm4
UniProt Entry Name
NSUN2_HUMAN

NCBI Description

This gene encodes a methyltransferase that catalyzes the methylation of cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. This modification is necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Mar 2011]

Uniprot Description

NSUN2: an RNA methyltransferase that methylates tRNAs, and possibly RNA polymerase III transcripts. Methylates cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. Not able to modify tRNAs at positions 48 or 49. May act downstream of Myc to regulate epidermal cell growth and proliferation. Required for proper spindle assembly and chromosome segregation, independently of its methyltransferase activity. Interacts with NPM1 and NCL during interphase. Concentrated in the nucleolus during interphase and translocates to the spindle during mitosis as an RNA-protein complex that includes 18S ribosomal RNA. Defects in NSUN2 are the cause of mental retardation autosomal recessive type 5 (MRT5), a disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Belongs to the methyltransferase superfamily. RsmB/NOP family. TRM4 subfamily. Two human isoforms produced by alternative splicing.

Protein type: EC 2.1.1.203; Methyltransferase; Nucleolus; RNA-binding

Chromosomal Location of Human Ortholog: 5p15.31

Cellular Component: cytoplasm; nucleolus; spindle; nucleus

Molecular Function: tRNA (cytosine-5-)-methyltransferase activity; tRNA binding

Biological Process: mitosis; cell division; tRNA methylation

Disease: Mental Retardation, Autosomal Recessive 5

Research Articles on NSUN2

Similar Products

Product Notes

The NSUN2 nsun2 (Catalog #AAA3209180) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NSUN2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NSUN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NSUN2 nsun2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FINSRIITVS MEDVKILLTQ ENPFFRKLSS ETYSQAKDLA KGSIVLKYEP. It is sometimes possible for the material contained within the vial of "NSUN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.