Rabbit anti-Human NRG4 Polyclonal Antibody | anti-NRG4 antibody

NRG4 (Pro-neuregulin-4, Membrane-bound Isoform, Pro-NRG4, DKFZp779N0541, DKFZp779N1944, HRG4) (FITC)

Cat. Num. AAA6387560

• Gene Names: NRG4; HRG4
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NRG4; Polyclonal Antibody; NRG4 (Pro-neuregulin-4; Membrane-bound Isoform; Pro-NRG4; DKFZp779N0541; DKFZp779N1944; HRG4) (FITC); anti-NRG4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NRG4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-NRG4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NRG4, aa1-115 (NP_612640.1).
• Immunogen Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NRG4 expression in transfected 293T cell line by NRG4 polyclonal antibody. Lane 1: NRG4 transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NRG4 antibody

The Pro-neuregulin-4, membrane-bound isoform contains 1 EGF-like domain and belongs to the neuregulin family. It is low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. However, it does not bind to the ERBB1, ERBB2 and ERBB3 receptors (By similarity).

Product Categories/Family for anti-NRG4 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 20070380
• NCBI GeneID: 145957
• NCBI Accession #: NP_612640.1
• NCBI GenBank Nucleotide #: NM_138573.1
• UniProt Accession #: Q8WWG1; A6NIE8
• Molecular Weight: 12,722 Da
• NCBI Official Full Name: pro-neuregulin-4, membrane-bound isoform
• NCBI Official Synonym Full Names: neuregulin 4
• NCBI Official Symbol: NRG4
• NCBI Official Synonym Symbols: HRG4
• NCBI Protein Information: pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4
• UniProt Protein Name: Pro-neuregulin-4, membrane-bound isoform
• Protein Family: Pro-neuregulin
• UniProt Gene Name: NRG4
• UniProt Synonym Gene Names: Pro-NRG4; NRG-4
• UniProt Entry Name: NRG4_HUMAN

NCBI Description

The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation (Harari et al., 1999 [PubMed 10348342]).[supplied by OMIM, Mar 2008]

Uniprot Description

NRG4: Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors. Belongs to the neuregulin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q24.2

Cellular Component: extracellular space; integral to membrane; extracellular region; plasma membrane

Molecular Function: growth factor activity; receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; organ development; innate immune response