Immunohistochemistry (IHC)
(Human Lung )
Rabbit NRF1 Polyclonal Antibody | anti-NRF1 antibody
NRF1 antibody - C-terminal region
Gene Names
NRF1; ALPHA-PAL
Reactivity
Tested: HumanPredicted: Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
NRF1; Polyclonal Antibody; NRF1 antibody - C-terminal region; anti-NRF1 antibody
Host
Rabbit
Reactivity
Tested: Human
Predicted: Human, Rat
Predicted: Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY
Sequence Length
522
Applicable Applications for anti-NRF1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NRF1
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express NRF1
Protein Size
522 amino acids
Protein Interactions
POGZ; TRAF2; SP4; FHL2; DYNLL1, CSNK2B; CSNK2A1; UBC; HHV8GK18_gp81; CEBPB; PARP1; PPRC1; MAFF; PPARGC1A; Dynlt1b; CDK1; MRPL57; TFAM
RNA Seq
Find tissues and cell lines supported by DNA array analysis to express NRF1.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Lung )
Immunohistochemistry (IHC)
(Human Lung )
Western Blot (WB)
(WB Suggested Anti-NRF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-NRF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-NRF1 antibody
This is a rabbit polyclonal antibody against NRF1. It was validated on Western Blot and immunohistochemistry
Target Description: NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth.This gene encodes a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized.
Target Description: NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth.This gene encodes a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized.
Product Categories/Family for anti-NRF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56kDa
NCBI Official Full Name
nuclear respiratory factor 1 isoform 1
NCBI Official Synonym Full Names
nuclear respiratory factor 1
NCBI Official Symbol
NRF1
NCBI Official Synonym Symbols
ALPHA-PAL
NCBI Protein Information
nuclear respiratory factor 1
Protein Family
NCBI Description
This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternative splicing results in multiple transcript variants. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1. [provided by RefSeq, May 2014]
Research Articles on NRF1
Similar Products
Product Notes
The NRF1 (Catalog #AAA3204138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NRF1 antibody - C-terminal region reacts with Tested: Human Predicted: Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NRF1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NRF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVLSGETAAA VGALTGVQDA NGLFMADRAG RKWILTDKAT GLVQIPVSMY. It is sometimes possible for the material contained within the vial of "NRF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
