Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NR6A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Rabbit NR6A1 Polyclonal Antibody | anti-NR6A1 antibody

NR6A1 antibody - middle region

Gene Names
NR6A1; RTR; GCNF; NR61; hRTR; CT150; GCNF1; hGCNF
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NR6A1; Polyclonal Antibody; NR6A1 antibody - middle region; anti-NR6A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILLSSLTVYSKQIFGELADVTAKYSPSDEELHRFSDEGMEVIERLIYLYH
Sequence Length
475
Applicable Applications for anti-NR6A1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NR6A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NR6A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-NR6A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-NR6A1 antibody
This is a rabbit polyclonal antibody against NR6A1. It was validated on Western Blot

Target Description: NR6A1 is an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in vivo targets have not been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
nuclear receptor subfamily 6 group A member 1 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 6 group A member 1
NCBI Official Symbol
NR6A1
NCBI Official Synonym Symbols
RTR; GCNF; NR61; hRTR; CT150; GCNF1; hGCNF
NCBI Protein Information
nuclear receptor subfamily 6 group A member 1
UniProt Protein Name
Nuclear receptor subfamily 6 group A member 1
UniProt Gene Name
NR6A1
UniProt Synonym Gene Names
GCNF; GCNF; hGCNF; RTR; hRTR
UniProt Entry Name
NR6A1_HUMAN

NCBI Description

This gene encodes an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in vivo targets have not been identified. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jun 2013]

Uniprot Description

NR6A1: Orphan nuclear receptor. Binds to a response element containing the sequence 5'-TCAAGGTCA-3'. May be involved in the regulation of gene expression in germ cell development during gametogenesis. Homodimer. Interacts with UIMC1. Shows highest expression in the germ cells of the adult testis. Belongs to the nuclear hormone receptor family. NR6 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 9q33.3

Cellular Component: nucleoplasm; transcription factor complex

Molecular Function: ligand-dependent nuclear receptor activity; protein homodimerization activity; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity

Biological Process: transcription initiation from RNA polymerase II promoter; cell proliferation; intracellular receptor-mediated signaling pathway; gamete generation; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; spermatogenesis; negative regulation of transcription from RNA polymerase II promoter

Research Articles on NR6A1

Similar Products

Product Notes

The NR6A1 nr6a1 (Catalog #AAA3207845) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR6A1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's NR6A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR6A1 nr6a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILLSSLTVYS KQIFGELADV TAKYSPSDEE LHRFSDEGME VIERLIYLYH. It is sometimes possible for the material contained within the vial of "NR6A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.