Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NR2E3 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit NR2E3 Polyclonal Antibody | anti-NR2E3 antibody

NR2E3 antibody - N-terminal region

Gene Names
NR2E3; PNR; RNR; rd7; ESCS; RP37
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
NR2E3; Polyclonal Antibody; NR2E3 antibody - N-terminal region; anti-NR2E3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC
Sequence Length
410
Applicable Applications for anti-NR2E3 antibody
Western Blot (WB)
Homology
Cow: 86%; Human: 100%; Mouse: 93%; Pig: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NR2E3 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NR2E3 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-NR2E3 antibody
This is a rabbit polyclonal antibody against NR2E3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NR2E3 is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. NR2E3 is a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome.This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
photoreceptor-specific nuclear receptor isoform b
NCBI Official Synonym Full Names
nuclear receptor subfamily 2 group E member 3
NCBI Official Symbol
NR2E3
NCBI Official Synonym Symbols
PNR; RNR; rd7; ESCS; RP37
NCBI Protein Information
photoreceptor-specific nuclear receptor
UniProt Protein Name
Photoreceptor-specific nuclear receptor
UniProt Gene Name
NR2E3
UniProt Synonym Gene Names
PNR; RNR
UniProt Entry Name
NR2E3_HUMAN

NCBI Description

This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

NR2E3: Orphan nuclear receptor of retinal photoreceptor cells. Transcriptional factor that is an activator of rod development and repressor of cone development. Binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. Enhances rhodopsin expression. Represses M- and S-cone opsin expression. Defects in NR2E3 are a cause of enhanced S cone syndrome (ESCS). ESCS is an autosomal recessive retinopathy in which patients have increased sensitivity to blue light; perception of blue light is mediated by what is normally the least populous cone photoreceptor subtype, the S (short wavelength, blue) cones. ESCS is also associated with visual loss, with night blindness occurring from early in life, varying degrees of L (long, red)- and M (middle, green)-cone vision, and retinal degeneration. Defects in NR2E3 are the cause of retinitis pigmentosa type 37 (RP37). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP37 inheritance is autosomal dominant. Belongs to the nuclear hormone receptor family. NR2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; positive regulation of rhodopsin gene expression; negative regulation of transcription from RNA polymerase II promoter; signal transduction; negative regulation of cell proliferation; eye photoreceptor cell development; visual perception; retina development in camera-type eye; phototransduction; steroid hormone mediated signaling; gene expression; positive regulation of transcription from RNA polymerase II promoter

Disease: Retinitis Pigmentosa 37; Enhanced S-cone Syndrome

Research Articles on NR2E3

Similar Products

Product Notes

The NR2E3 nr2e3 (Catalog #AAA3204422) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR2E3 antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NR2E3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR2E3 nr2e3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: METRPTALMS STVAAAAPAA GAASRKESPG RWGLGEDPTG VSPSLQCRVC. It is sometimes possible for the material contained within the vial of "NR2E3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.