Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human NR2C2AP Polyclonal Antibody | anti-NR2C2AP antibody

NR2C2AP Polyclonal Antibody

Gene Names
NR2C2AP; TRA16
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NR2C2AP; Polyclonal Antibody; NR2C2AP Polyclonal Antibody; TRA16; anti-NR2C2AP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
Sequence Length
167
Applicable Applications for anti-NR2C2AP antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human NR2C2AP
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-NR2C2AP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa/19kDa
NCBI Official Full Name
nuclear receptor 2C2-associated protein isoform 1
NCBI Official Synonym Full Names
nuclear receptor 2C2 associated protein
NCBI Official Symbol
NR2C2AP
NCBI Official Synonym Symbols
TRA16
NCBI Protein Information
nuclear receptor 2C2-associated protein
UniProt Protein Name
Nuclear receptor 2C2-associated protein
UniProt Gene Name
NR2C2AP
UniProt Synonym Gene Names
TRA16

Uniprot Description

May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.

Research Articles on NR2C2AP

Similar Products

Product Notes

The NR2C2AP nr2c2ap (Catalog #AAA9134951) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR2C2AP Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR2C2AP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the NR2C2AP nr2c2ap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTHSLVCPET VSRVSSVLNR NTRQFGKKHL FDQDEETCWN SDQGPSQWVT LEFPQLIRVS QLQIQFQGGF SSRRGCLEGS QGTQALHKIV DFYPEDNNSL QTFPIPAAEV DRLKVTFEDA TDFFGRVVIY HLRVLGEKV. It is sometimes possible for the material contained within the vial of "NR2C2AP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.