Western Blot (WB)
(WB Suggested Anti-Nr0b1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)
Rabbit Nr0b1 Polyclonal Antibody | anti-NR0B1 antibody
Nr0b1 Antibody - C-terminal region
Gene Names
Nr0b1; AHX; Ahc; Ahch; Dax1; DAX-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nr0b1; Polyclonal Antibody; Nr0b1 Antibody - C-terminal region; anti-NR0B1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF
Sequence Length
472
Applicable Applications for anti-NR0B1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 75%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr0b1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Nr0b1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)
Western Blot (WB)
(WB Suggested Anti-Nr0b1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)
Related Product Information for anti-NR0B1 antibody
This is a rabbit polyclonal antibody against Nr0b1. It was validated on Western Blot
Target Description: Nr0b1 is an orphan nuclear receptor and a component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Nr0b1 acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. Nr0b1 may also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency.
Target Description: Nr0b1 is an orphan nuclear receptor and a component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Nr0b1 acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. Nr0b1 may also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency.
Product Categories/Family for anti-NR0B1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
nuclear receptor subfamily 0 group B member 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 0, group B, member 1
NCBI Official Symbol
Nr0b1
NCBI Official Synonym Symbols
AHX; Ahc; Ahch; Dax1; DAX-1
NCBI Protein Information
nuclear receptor subfamily 0 group B member 1
UniProt Protein Name
Nuclear receptor subfamily 0 group B member 1
Protein Family
UniProt Gene Name
Nr0b1
UniProt Synonym Gene Names
Ahch; Dax1
UniProt Entry Name
NR0B1_MOUSE
NCBI Description
This gene encodes an orphan nuclear receptor protein that plays a key role in differentiation of the gonads. This protein regulates steroidogenic factor 1 (Sf-1) in a dose-dependent manner, sometimes functioning as a repressor of SF-1 target genes, and sometimes functioning as a co-activator. Overexpression of this gene can cause feminization of the XY male gonads. This gene is also involved in the maintenance of embryonic stem cell pluripotancy. Mutations in the related gene in human cause congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq, May 2015]
Research Articles on NR0B1
Similar Products
Product Notes
The NR0B1 nr0b1 (Catalog #AAA3201214) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nr0b1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Nr0b1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR0B1 nr0b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YIEGLQWRTQ QILTEHIRMM QREYQIRSAE LNSALFLLRF INSDVVTELF. It is sometimes possible for the material contained within the vial of "Nr0b1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
