Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NODAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Rabbit NODAL Polyclonal Antibody | anti-NODAL antibody

NODAL antibody - middle region

Gene Names
NODAL; HTX5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NODAL; Polyclonal Antibody; NODAL antibody - middle region; anti-NODAL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH
Sequence Length
347
Applicable Applications for anti-NODAL antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NODAL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NODAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-NODAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-NODAL antibody
This is a rabbit polyclonal antibody against NODAL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
nodal homolog isoform 1 preproprotein
NCBI Official Synonym Full Names
nodal growth differentiation factor
NCBI Official Symbol
NODAL
NCBI Official Synonym Symbols
HTX5
NCBI Protein Information
nodal homolog
UniProt Protein Name
Nodal homolog
Protein Family
UniProt Gene Name
NODAL
UniProt Entry Name
NODAL_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which regulates early embryonic development. This protein is required for maintenance of human embryonic stem cell pluripotency and may play a role in human placental development. Mutations in this gene are associated with heterotaxy, a condition characterized by random orientation of visceral organs with respect to the left-right axis. [provided by RefSeq, Aug 2016]

Uniprot Description

NODAL: Essential for mesoderm formation and axial patterning during embryonic development. Defects in NODAL are the cause of visceral heterotaxy autosomal type 5 (HTX5). A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects. Clinical features of visceral heterotaxy autosomal type 5 include situs inversus viscerum or situs ambiguus, congenital heart defect, transposition of the great vessels ventricular septal defect, atrial septal defect, truncuscommunis, and dextrocardia. Belongs to the TGF-beta family.

Protein type: Cytokine; Cell development/differentiation; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: extracellular space

Molecular Function: morphogen activity; growth factor activity; cytokine activity; receptor agonist activity; transforming growth factor beta receptor binding

Biological Process: embryonic placenta development; mesendoderm development; positive regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; axial mesodermal cell fate specification; embryonic pattern specification; positive regulation of activin receptor signaling pathway; floor plate morphogenesis; vasculature development; regulation of gastrulation; positive regulation of cell-cell adhesion; trophectodermal cellular morphogenesis; heart looping; cell migration involved in gastrulation; maternal placenta development; placenta development; embryonic process involved in female pregnancy; stem cell maintenance; digestive tract morphogenesis; embryonic cranial skeleton morphogenesis; liver development; formation of anatomical boundary; neural fold formation; positive regulation of angiogenesis; repression of premature neural plate formation; polarity specification of proximal/distal axis; maternal process involved in parturition; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; brain development; positive regulation of epithelial cell proliferation; growth

Disease: Heterotaxy, Visceral, 5, Autosomal

Research Articles on NODAL

Similar Products

Product Notes

The NODAL nodal (Catalog #AAA3213174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NODAL antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NODAL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NODAL nodal for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFHPTNHAYI QSLLKRYQPH RVPSTCCAPV KTKPLSMLYV DNGRVLLDHH. It is sometimes possible for the material contained within the vial of "NODAL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.