Immunohistochemistry (IHC)
(Human Heart )
Rabbit anti-Human NOBOX Polyclonal Antibody | anti-NOBOX antibody
NOBOX antibody - N-terminal region
Gene Names
NOBOX; OG2; OG-2; OG2X; POF5; TCAG_12042
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NOBOX; Polyclonal Antibody; NOBOX antibody - N-terminal region; anti-NOBOX antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPVCGLYRIYGVCGSFSSFFIIRCSLCALETLKSPQHDPLEIPEQSLKLI
Sequence Length
490
Applicable Applications for anti-NOBOX antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NOBOX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Heart )
Immunohistochemistry (IHC)
(Human Heart )
Immunohistochemistry (IHC)
(Human Liver )
Immunohistochemistry (IHC)
(Human Liver )
Western Blot (WB)
(WB Suggested Anti-NOBOX Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-NOBOX Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-NOBOX antibody
This is a rabbit polyclonal antibody against NOBOX. It was validated on Western Blot and immunohistochemistry
Target Description: NOBOX is a transcription factor which may play a role in oogenesis. It binds preferentially to the DNA sequences 5'-TAATTG-3', 5'-TAGTTG-3' and 5'-TAATTA-3'.
Target Description: NOBOX is a transcription factor which may play a role in oogenesis. It binds preferentially to the DNA sequences 5'-TAATTG-3', 5'-TAGTTG-3' and 5'-TAATTA-3'.
Product Categories/Family for anti-NOBOX antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
homeobox protein NOBOX
NCBI Official Synonym Full Names
NOBOX oogenesis homeobox
NCBI Official Symbol
NOBOX
NCBI Official Synonym Symbols
OG2; OG-2; OG2X; POF5; TCAG_12042
NCBI Protein Information
homeobox protein NOBOX
UniProt Protein Name
Homeobox protein NOBOX
Protein Family
UniProt Gene Name
NOBOX
UniProt Entry Name
NOBOX_HUMAN
NCBI Description
This homeobox gene encodes a transcription factor that is thought to play a role in oogenesis. In mice, it is essential for folliculogenesis and regulation of oocyte-specific genes. Defects in this gene result in premature ovarian failure type 5.[provided by RefSeq, May 2011]
Research Articles on NOBOX
Similar Products
Product Notes
The NOBOX nobox (Catalog #AAA3205012) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOBOX antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOBOX can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NOBOX nobox for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPVCGLYRIY GVCGSFSSFF IIRCSLCALE TLKSPQHDPL EIPEQSLKLI. It is sometimes possible for the material contained within the vial of "NOBOX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
