Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NMUR1Antibody Dilution: 1.0ug/mlSample Type: A549 cell lysateNMUR1 is supported by BioGPS gene expression data to be expressed in A549)

Rabbit anti-Human NMUR1 Polyclonal Antibody | anti-NMUR1 antibody

NMUR1 antibody - C-terminal region

Gene Names
NMUR1; FM3; FM-3; GPC-R; GPR66; NMU1R; (FM-3)
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NMUR1; Polyclonal Antibody; NMUR1 antibody - C-terminal region; anti-NMUR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS
Sequence Length
403
Applicable Applications for anti-NMUR1 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NMUR1Antibody Dilution: 1.0ug/mlSample Type: A549 cell lysateNMUR1 is supported by BioGPS gene expression data to be expressed in A549)

Western Blot (WB) (Host: RabbitTarget Name: NMUR1Antibody Dilution: 1.0ug/mlSample Type: A549 cell lysateNMUR1 is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-NMUR1 antibody
This is a rabbit polyclonal antibody against NMUR1. It was validated on Western Blot

Target Description: NMUR1 is a receptor for the neuromedin-U and neuromedin-S neuropeptides.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
orphan G protein-coupled receptor
NCBI Official Synonym Full Names
neuromedin U receptor 1
NCBI Official Symbol
NMUR1
NCBI Official Synonym Symbols
FM3; FM-3; GPC-R; GPR66; NMU1R; (FM-3)
NCBI Protein Information
neuromedin-U receptor 1
UniProt Protein Name
Neuromedin-U receptor 1
Protein Family
UniProt Gene Name
NMUR1
UniProt Synonym Gene Names
GPR66; NMU-R1
UniProt Entry Name
NMUR1_HUMAN

Uniprot Description

NMUR1: Receptor for the neuromedin-U and neuromedin-S neuropeptides. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; neuropeptide receptor activity; neuromedin U receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; inositol phosphate-mediated signaling; smooth muscle contraction; phospholipase C activation; neuropeptide signaling pathway; calcium ion transport; calcium-mediated signaling; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); chloride transport

Similar Products

Product Notes

The NMUR1 nmur1 (Catalog #AAA3216649) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMUR1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NMUR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NMUR1 nmur1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CHRLRPRHSS HSLSRMTTGS TLCDVGSLGS WVHPLAGNDG PEAQQETDPS. It is sometimes possible for the material contained within the vial of "NMUR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.