nmt55/p54nrb Polyclonal Antibody | anti-NONO antibody

Anti-nmt55/p54nrb Antibody

Cat. Num. AAA178047

• Gene Names: NONO; P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: nmt55/p54nrb; Polyclonal Antibody; Anti-nmt55/p54nrb Antibody; Non-POU domain-containing octamer-binding protein; 52 kDa subunit; 54 kDa nuclear RNA and DNA binding protein; 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; DNA binding p52/p100 complex 52 kDa subunit; DNA-binding p52/p100 complex; NMT 55; NMT55; Non Pou domain containing octamer (ATGCAAAT) binding protein; Non POU domain containing octamer binding; Non POU domain containing octamer binding protein; Nono; NonO protein; NONO_HUMAN; NRB 54; NRB; NRB54; Nuclear RNA binding protein 54kD; P54; p54(nrb); p54nrb; PPP1R114; Protein phosphatase 1 regulatory subunit 114; non-POU domain containing; octamer-binding; anti-NONO antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 471

• Applicable Applications for anti-NONO antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of nmt55/p54nrb expression in rat brain extract (lane 1), human placenta extract (lane 2) and PANC whole cell lysates (lane 3). nmt55/p54nrb at 60KD was detected using rabbit anti-FBXL4 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(nmt55/p54nrb was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(nmt55/p54nrb was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(nmt55/p54nrb was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-NONO antibody

Description: Rabbit IgG polyclonal antibody for Non-POU domain-containing octamer-binding protein(NONO) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. 

References

1. "Entrez Gene: NONO Non-POU domain containing, octamer-binding". 2. Dong B, Horowitz DS, Kobayashi R, Krainer AR (Oct 1993). "Purification and cDNA cloning of HeLa cell p54nrb, a nuclear protein with two RNA recognition motifs and extensive homology to human splicing factor PSF and Drosophila NONA/BJ6". Nucleic Acids Res. 21 (17): 4085-92. 3. Traish AM, Huang YH, Ashba J, Pronovost M, Pavao M, McAneny DB, Moreland RB (Dec 1997). "Loss of expression of a 55 kDa nuclear protein (nmt55) in estrogen receptor-negative human breast cancer". Diagn. Mol. Pathol. 6(4): 209-21.

NCBI and Uniprot Product Information

• NCBI GI #: 224028244
• NCBI GeneID: 4841
• NCBI Accession #: NP_001138880.1
• NCBI GenBank Nucleotide #: NM_001145408.1
• UniProt Accession #: Q15233; O00201; P30807; Q12786; Q9BQC5; B7Z4C2; D3DVV4; F5GYZ3
• Molecular Weight: 43,866 Da
• NCBI Official Full Name: non-POU domain-containing octamer-binding protein isoform 1
• NCBI Official Synonym Full Names: non-POU domain containing, octamer-binding
• NCBI Official Symbol: NONO
• NCBI Official Synonym Symbols: P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
• NCBI Protein Information: non-POU domain-containing octamer-binding protein
• UniProt Protein Name: Non-POU domain-containing octamer-binding protein
• Protein Family: Non-POU domain-containing octamer-binding protein
• UniProt Gene Name: NONO
• UniProt Synonym Gene Names: NRB54; NonO protein; p54nrb
• UniProt Entry Name: NONO_HUMAN

NCBI Description

This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009]

Uniprot Description

NONO: DNA- and RNA binding protein, involved in several nuclear processes. Binds the conventional octamer sequence in double stranded DNA. Also binds single-stranded DNA and RNA at a site independent of the duplex site. Involved in pre-mRNA splicing, probably as a heterodimer with SFPQ. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1. The SFPQ-NONO heteromer may be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. In vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. NONO is involved in transcriptional regulation. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription. Together with PSPC1, required for the formation of nuclear paraspeckles. A chromosomal aberration involving NONO may be a cause of papillary renal cell carcinoma (PRCC). Translocation t(X;X)(p11.2;q13.1) with TFE3.

Protein type: Nuclear receptor co-regulator; RNA-binding; Nucleolus; RNA splicing

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: membrane; nuclear matrix; nuclear speck; nucleolus; nucleoplasm; nucleus; paraspeckles

Molecular Function: chromatin binding; identical protein binding; nucleotide binding; protein binding

Biological Process: circadian rhythm; DNA recombination; DNA repair; mRNA processing; negative regulation of transcription, DNA-dependent; nuclear mRNA splicing, via spliceosome; regulation of circadian rhythm; regulation of transcription, DNA-dependent; RNA splicing; transcription, DNA-dependent