Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dot Blot (DB) (DB Suggested Anti-Nme1 antibodyTitration: 0.5 ug/mlPositive Control: Recomninant human NME2 protein)

Rabbit NME1 Polyclonal Antibody | anti-NME1 antibody

NME1 antibody - N-terminal region

Gene Names
NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Dot Blot, Western Blot, Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NME1; Polyclonal Antibody; NME1 antibody - N-terminal region; anti-NME1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH
Sequence Length
152
Applicable Applications for anti-NME1 antibody
Dot Blot (WB), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NME1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Dot Blot (DB)

(DB Suggested Anti-Nme1 antibodyTitration: 0.5 ug/mlPositive Control: Recomninant human NME2 protein)

Dot Blot (DB) (DB Suggested Anti-Nme1 antibodyTitration: 0.5 ug/mlPositive Control: Recomninant human NME2 protein)
Related Product Information for anti-NME1 antibody
This is a rabbit polyclonal antibody against NME1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
nucleoside diphosphate kinase A isoform b
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 1
NCBI Official Symbol
NME1
NCBI Official Synonym Symbols
NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
NCBI Protein Information
nucleoside diphosphate kinase A
UniProt Protein Name
Nucleoside diphosphate kinase B
UniProt Gene Name
NME2
UniProt Synonym Gene Names
NM23B; NDK B; NDP kinase B
UniProt Entry Name
NDKB_HUMAN

NCBI Description

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Jul 2008]

Uniprot Description

NME2: Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed:8392752). Exhibits histidine protein kinase activity. Belongs to the NDK family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, other; Nucleotide Metabolism - pyrimidine; EC 2.7.13.3; Nucleotide Metabolism - purine; Nuclear receptor co-regulator; EC 2.7.4.6; Kinase, nucleoside diphosphate; Other group; NDK family

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: ruffle; centrosome; focal adhesion; membrane; mitochondrion; perinuclear region of cytoplasm; lamellipodium; cytoplasm; intermediate filament; cytosol; nucleus

Molecular Function: gamma-tubulin binding; protein binding; protein histidine kinase activity; metal ion binding; nucleoside diphosphate kinase activity; intermediate filament binding; protein kinase binding; transcription factor activity; ATP binding; single-stranded DNA binding

Biological Process: integrin-mediated signaling pathway; GTP biosynthetic process; peptidyl-histidine phosphorylation; response to cAMP; transcription, DNA-dependent; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; negative regulation of myeloid leukocyte differentiation; UTP biosynthetic process; hippocampus development; nucleoside diphosphate phosphorylation; response to testosterone stimulus; CTP biosynthetic process; regulation of transcription, DNA-dependent; pyrimidine nucleotide metabolic process; nucleoside triphosphate biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; cell adhesion; positive regulation of epithelial cell proliferation; regulation of epidermis development; response to amine stimulus; positive regulation of keratinocyte differentiation; purine nucleotide metabolic process; negative regulation of apoptosis

Research Articles on NME1

Similar Products

Product Notes

The NME1 nme2 (Catalog #AAA3224310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NME1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NME1 can be used in a range of immunoassay formats including, but not limited to, Dot Blot (WB), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NME1 nme2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ANCERTFIAI KPDGVQRGLV GEIIKRFEQK GFRLVGLKFM QASEDLLKEH. It is sometimes possible for the material contained within the vial of "NME1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.