Rabbit anti-Human NME1 Polyclonal Antibody | anti-NME1 antibody

NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-associated Protein, nm23-H1) (HRP)

Cat. Num. AAA6387143

• Gene Names: NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NME1; Polyclonal Antibody; NME1 (NDPKA; NM23; Nucleoside Diphosphate Kinase A; NDK A; NDP Kinase A; Granzyme A-activated DNase; GAAD; Metastasis Inhibition Factor nm23; Tumor Metastatic Process-associated Protein; nm23-H1) (HRP); anti-NME1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NME1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-NME1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NME1, aa1-177.
• Immunogen Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NME1 expression in transfected 293T cell line by NME1 polyclonal antibody. Lane 1: NME1 transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NME1 antibody

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Product Categories/Family for anti-NME1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4557797
• NCBI GeneID: 4830
• NCBI Accession #: NP_000260.1
• NCBI GenBank Nucleotide #: NM_198175
• UniProt Accession #: P15531; Q6FGK3; Q86XQ2; Q9UDJ6
• Molecular Weight: 17,149 Da
• NCBI Official Full Name: nucleoside diphosphate kinase A isoform b
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 1
• NCBI Official Symbol: NME1
• NCBI Official Synonym Symbols: NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
• NCBI Protein Information: nucleoside diphosphate kinase A; NDP kinase A; granzyme A-activated DNase; metastasis inhibition factor nm23; tumor metastatic process-associated protein; non-metastatic cells 1, protein (NM23A) expressed in
• UniProt Protein Name: Nucleoside diphosphate kinase A
• Protein Family: Nucleoside diphosphate kinase
• UniProt Gene Name: NME1
• UniProt Synonym Gene Names: NDPKA; NM23; NDK A; NDP kinase A; GAAD
• UniProt Entry Name: NDKA_HUMAN

NCBI Description

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Jul 2008]

Uniprot Description

NME1: an enzyme with multiple activities including histidine protein kinase, nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase and 3'-5' exonuclease activities. Plays a major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Involved in cell proliferation, differentiation and development, G protein-coupled receptor endocytosis, cytotoxic T cell and NK cell-mediated cell death, and gene expression. Required for neural development including neural patterning and cell fate determination. During granzyme A (GZMA)-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair. Three alternatively spliced human proteins have been reported.

Protein type: Nucleotide Metabolism - purine; Kinase, nucleoside diphosphate; Kinase, other; EC 2.7.4.6; Tumor suppressor; Protein kinase, histidine; Nucleotide Metabolism - pyrimidine; Other group; NDK family

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: mitochondrion; membrane; cytoplasm; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; GTP binding; deoxyribonuclease activity; nucleoside diphosphate kinase activity; magnesium ion binding; ATP binding; ribosomal small subunit binding

Biological Process: GTP biosynthetic process; nervous system development; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; UTP biosynthetic process; nucleoside diphosphate phosphorylation; endocytosis; DNA catabolic process; regulation of apoptosis; negative regulation of cell proliferation; CTP biosynthetic process; pyrimidine nucleotide metabolic process; nucleoside triphosphate biosynthetic process; cell differentiation; positive regulation of epithelial cell proliferation; positive regulation of DNA binding; purine nucleotide metabolic process

Disease: Neuroblastoma, Susceptibility To